Symbol:
Yars1
Name:
tyrosyl-tRNA synthetase 1
RGD ID:
1307616
Description:
Predicted to enable small molecule binding activity and tyrosine-tRNA ligase activity. Predicted to be involved in response to starvation and tyrosyl-tRNA aminoacylation. Predicted to be located in nuclear body. Predicted to be active in cytosol and nucleus. Human ortholog(s) of this gene implicated in Charcot-Marie-Tooth disease dominant intermediate C. Orthologous to human YARS1 (tyrosyl-tRNA synthetase 1); PARTICIPATES IN phenylketonuria pathway; tyrosinemia type II pathway; tyrosinemia type III pathway; INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC313047; MGC112837; tyrosine--tRNA ligase, cytoplasmic; tyrosyl--tRNA ligase; tyrosyl-tRNA synthetase; tyrosyl-tRNA synthetase, cytoplasmic; tyrRS; Yars
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
YARS1 (tyrosyl-tRNA synthetase 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Yars1 (tyrosyl-tRNA synthetase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Yars1 (tyrosyl-tRNA synthetase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
YARS1 (tyrosyl-tRNA synthetase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
YARS1 (tyrosyl-tRNA synthetase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Yars1 (tyrosyl-tRNA synthetase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
YARS1 (tyrosyl-tRNA synthetase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
YARS1 (tyrosyl-tRNA synthetase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Yars1 (tyrosyl-tRNA synthetase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
YARS1 (tyrosyl-tRNA synthetase 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Yars1 (tyrosyl-tRNA synthetase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
yars (tyrosyl-tRNA synthetase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
TyrRS
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
TYS1
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|SonicParanoid)
Caenorhabditis elegans (roundworm):
yars-1
Alliance
DIOPT (OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
yars1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 146,820,163 - 146,848,377 (+) NCBI GRCr8 mRatBN7.2 5 141,535,815 - 141,564,029 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 141,535,759 - 141,563,833 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 144,233,688 - 144,262,170 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 146,003,509 - 146,031,990 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 146,003,105 - 146,031,352 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 147,375,350 - 147,403,578 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 147,375,350 - 147,403,571 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 151,109,967 - 151,138,479 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 148,350,363 - 148,378,989 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 148,360,401 - 148,389,028 (+) NCBI Celera 5 140,015,592 - 140,043,428 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Yars1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of YARS1 mRNA] CTD PMID:31150632 Yars1 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO YARS1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of YARS1 mRNA CTD PMID:22079256 Yars1 Rat (1->4)-beta-D-glucan multiple interactions ISO Yars1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of YARS1 mRNA CTD PMID:36331819 Yars1 Rat 1,2-dichloroethane decreases expression ISO Yars1 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of YARS1 mRNA CTD PMID:28960355 Yars1 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of YARS1 mRNA CTD PMID:20551477 Yars1 Rat 17alpha-ethynylestradiol multiple interactions ISO Yars1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of YARS1 mRNA CTD PMID:17942748 Yars1 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of YARS1 mRNA CTD PMID:32145629 Yars1 Rat 17beta-estradiol increases expression ISO Yars1 (Mus musculus) 6480464 Estradiol results in increased expression of YARS1 mRNA CTD PMID:39298647 Yars1 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of YARS1 mRNA CTD PMID:26496021 Yars1 Rat 17beta-estradiol increases expression ISO YARS1 (Homo sapiens) 6480464 Estradiol results in increased expression of YARS1 mRNA CTD PMID:20106945 and PMID:31614463 Yars1 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO YARS1 (Homo sapiens) 6480464 2 more ... CTD PMID:19095052 Yars1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO YARS1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Yars1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Yars1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of YARS1 mRNA CTD PMID:17942748 Yars1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of YARS1 mRNA CTD PMID:33387578 Yars1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of YARS1 mRNA CTD PMID:21346803 Yars1 Rat 2,6-dimethoxyphenol multiple interactions ISO YARS1 (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Yars1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of YARS1 mRNA CTD PMID:21346803 Yars1 Rat 2-palmitoylglycerol increases expression ISO YARS1 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of YARS1 mRNA CTD PMID:37199045 Yars1 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin analog results in increased expression of YARS1 protein and alpha-Chlorohydrin results in increased expression of YARS1 protein CTD PMID:26597043 and PMID:34915118 Yars1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO YARS1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of YARS1 mRNA CTD PMID:28628672 Yars1 Rat 4,4'-sulfonyldiphenol increases expression ISO Yars1 (Mus musculus) 6480464 bisphenol S results in increased expression of YARS1 mRNA CTD PMID:39298647 Yars1 Rat 4,4'-sulfonyldiphenol increases expression ISO YARS1 (Homo sapiens) 6480464 bisphenol S results in increased expression of YARS1 protein CTD PMID:34186270 Yars1 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of YARS1 mRNA CTD PMID:21346803 Yars1 Rat 5-fluorouracil multiple interactions ISO YARS1 (Homo sapiens) 6480464 TP53 protein affects the reaction [Fluorouracil results in decreased expression of YARS1 mRNA] CTD PMID:15016801 Yars1 Rat acrylamide increases expression ISO YARS1 (Homo sapiens) 6480464 Acrylamide results in increased expression of YARS1 mRNA CTD PMID:32763439 Yars1 Rat adefovir pivoxil decreases expression ISO YARS1 (Homo sapiens) 6480464 adefovir dipivoxil results in decreased expression of YARS1 mRNA CTD PMID:25596134 Yars1 Rat aflatoxin B1 decreases methylation ISO YARS1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of YARS1 intron CTD PMID:30157460 Yars1 Rat all-trans-retinoic acid decreases expression ISO YARS1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of YARS1 mRNA CTD PMID:33167477 Yars1 Rat AM-251 increases expression ISO YARS1 (Homo sapiens) 6480464 AM 251 results in increased expression of YARS1 mRNA CTD PMID:16500647 Yars1 Rat aristolochic acid A increases expression ISO YARS1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of YARS1 protein CTD PMID:33212167 Yars1 Rat benzo[a]pyrene increases expression ISO Yars1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of YARS1 mRNA CTD PMID:20504355 Yars1 Rat benzo[a]pyrene affects methylation ISO YARS1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of YARS1 exon CTD PMID:30157460 Yars1 Rat benzo[a]pyrene decreases expression ISO YARS1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of YARS1 protein CTD PMID:32717239 Yars1 Rat bisphenol A affects expression ISO YARS1 (Homo sapiens) 6480464 bisphenol A affects the expression of YARS1 mRNA CTD PMID:30903817 Yars1 Rat bisphenol A increases expression ISO Yars1 (Mus musculus) 6480464 bisphenol A results in increased expression of YARS1 mRNA CTD PMID:33221593 Yars1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of YARS1 mRNA CTD PMID:32145629 and PMID:34947998 Yars1 Rat bisphenol A increases expression ISO YARS1 (Homo sapiens) 6480464 bisphenol A results in increased expression of YARS1 mRNA CTD PMID:29275510 Yars1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of YARS1 mRNA CTD PMID:25181051 Yars1 Rat bisphenol A decreases expression ISO YARS1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of YARS1 mRNA CTD PMID:20678512 Yars1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of YARS1 mRNA CTD PMID:26496021 Yars1 Rat bisphenol AF increases expression ISO YARS1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of YARS1 protein CTD PMID:34186270 Yars1 Rat Bisphenol B increases expression ISO YARS1 (Homo sapiens) 6480464 bisphenol B results in increased expression of YARS1 protein CTD PMID:34186270 Yars1 Rat bisphenol F multiple interactions ISO YARS1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of YARS1 mRNA CTD PMID:28628672 Yars1 Rat bisphenol F increases expression ISO YARS1 (Homo sapiens) 6480464 bisphenol F results in increased expression of YARS1 protein CTD PMID:34186270 Yars1 Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of YARS1 protein CTD PMID:28903499 Yars1 Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of YARS1 mRNA CTD PMID:24136188 Yars1 Rat butan-1-ol multiple interactions ISO YARS1 (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of YARS1 mRNA CTD PMID:29432896 Yars1 Rat cadmium dichloride increases expression ISO YARS1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of YARS1 mRNA CTD PMID:25596134 Yars1 Rat cadmium dichloride affects localization ISO YARS1 (Homo sapiens) 6480464 Cadmium Chloride affects the localization of YARS1 protein CTD PMID:18261755 Yars1 Rat carbamazepine affects expression ISO YARS1 (Homo sapiens) 6480464 Carbamazepine affects the expression of YARS1 mRNA CTD PMID:25979313 Yars1 Rat CGP 52608 multiple interactions ISO YARS1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to YARS1 gene] CTD PMID:28238834 Yars1 Rat chloroacetaldehyde decreases expression ISO YARS1 (Homo sapiens) 6480464 chloroacetaldehyde results in decreased expression of YARS1 mRNA CTD PMID:25596134 Yars1 Rat chloropicrin increases expression ISO YARS1 (Homo sapiens) 6480464 chloropicrin results in increased expression of YARS1 mRNA CTD PMID:26352163 Yars1 Rat cidofovir anhydrous affects expression ISO YARS1 (Homo sapiens) 6480464 Cidofovir affects the expression of YARS1 mRNA CTD PMID:25596134 Yars1 Rat cisplatin decreases expression ISO YARS1 (Homo sapiens) 6480464 Cisplatin results in decreased expression of YARS1 mRNA and Cisplatin results in decreased expression of YARS1 protein CTD PMID:20540955 and PMID:25596134 Yars1 Rat cisplatin affects response to substance ISO YARS1 (Homo sapiens) 6480464 YARS1 protein affects the susceptibility to Cisplatin CTD PMID:16217747 Yars1 Rat clodronic acid decreases expression ISO YARS1 (Homo sapiens) 6480464 Clodronic Acid results in decreased expression of YARS1 mRNA CTD PMID:25596134 Yars1 Rat clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of YARS1 protein CTD PMID:16470657 Yars1 Rat copper(II) sulfate increases expression ISO YARS1 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of YARS1 mRNA CTD PMID:19549813 Yars1 Rat cyclosporin A increases expression ISO YARS1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of YARS1 mRNA CTD PMID:20106945 more ... Yars1 Rat cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of YARS1 mRNA CTD PMID:25596134 Yars1 Rat DDE increases expression ISO YARS1 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of YARS1 mRNA CTD PMID:38568856 Yars1 Rat dexamethasone multiple interactions ISO YARS1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of YARS1 mRNA CTD PMID:28628672 Yars1 Rat dioxygen decreases expression ISO YARS1 (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of YARS1 mRNA CTD PMID:25596134 Yars1 Rat dioxygen multiple interactions ISO Yars1 (Mus musculus) 6480464 [sulforaphane affects the susceptibility to Oxygen] which affects the expression of YARS1 mRNA CTD PMID:30529165 Yars1 Rat dorsomorphin multiple interactions ISO YARS1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Yars1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of YARS1 mRNA CTD PMID:29391264 Yars1 Rat enzyme inhibitor multiple interactions ISO YARS1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of YARS1 protein CTD PMID:23301498 Yars1 Rat epoxiconazole decreases expression ISO Yars1 (Mus musculus) 6480464 epoxiconazole results in decreased expression of YARS1 mRNA CTD PMID:35436446 Yars1 Rat fenofibrate increases expression ISO YARS1 (Homo sapiens) 6480464 Fenofibrate results in increased expression of YARS1 mRNA CTD PMID:25596134 Yars1 Rat fenofibrate increases expression EXP 6480464 Fenofibrate results in increased expression of YARS1 mRNA CTD PMID:25596134 Yars1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of YARS1 mRNA CTD PMID:24136188 Yars1 Rat furfural multiple interactions ISO YARS1 (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Yars1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of YARS1 mRNA and Gentamicins results in increased expression of YARS1 protein CTD PMID:22061828 and PMID:33387578 Yars1 Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of YARS1 mRNA CTD PMID:24136188 Yars1 Rat hyaluronic acid multiple interactions EXP 6480464 Hyaluronic Acid analog inhibits the reaction [Hydrogen Peroxide results in decreased expression of YARS1 protein] CTD PMID:23178681 Yars1 Rat hydrogen peroxide multiple interactions EXP 6480464 Hyaluronic Acid analog inhibits the reaction [Hydrogen Peroxide results in decreased expression of YARS1 protein] CTD PMID:23178681 Yars1 Rat hydrogen peroxide decreases expression EXP 6480464 Hydrogen Peroxide results in decreased expression of YARS1 protein CTD PMID:23178681 Yars1 Rat ibuprofen increases expression ISO YARS1 (Homo sapiens) 6480464 Ibuprofen results in increased expression of YARS1 mRNA CTD PMID:25596134 Yars1 Rat indometacin multiple interactions ISO YARS1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of YARS1 mRNA CTD PMID:28628672 Yars1 Rat ivermectin decreases expression ISO YARS1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of YARS1 protein CTD PMID:32959892 Yars1 Rat lamivudine multiple interactions ISO YARS1 (Homo sapiens) 6480464 [Zidovudine co-treated with Lamivudine] results in increased expression of YARS1 mRNA CTD PMID:15784690 Yars1 Rat lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of YARS1 mRNA CTD PMID:11578147 Yars1 Rat leflunomide increases expression ISO YARS1 (Homo sapiens) 6480464 Leflunomide results in increased expression of YARS1 mRNA CTD PMID:28988120 Yars1 Rat mercury dibromide increases expression ISO YARS1 (Homo sapiens) 6480464 mercuric bromide results in increased expression of YARS1 mRNA CTD PMID:26272509 Yars1 Rat mercury dibromide multiple interactions ISO YARS1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of YARS1 mRNA CTD PMID:27188386 Yars1 Rat mercury dichloride increases expression EXP 6480464 Mercuric Chloride results in increased expression of YARS1 mRNA CTD PMID:16507785 Yars1 Rat metformin increases expression EXP 6480464 Metformin results in increased expression of YARS1 mRNA CTD PMID:25596134 Yars1 Rat methylmercury chloride increases expression ISO YARS1 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of YARS1 mRNA CTD PMID:23179753 and PMID:28001369 Yars1 Rat N(4)-hydroxycytidine decreases expression ISO Yars1 (Mus musculus) 6480464 N(4)-hydroxycytidine results in decreased expression of YARS mRNA CTD PMID:37748715 Yars1 Rat N-methyl-4-phenylpyridinium increases expression ISO YARS1 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of YARS1 mRNA CTD PMID:24810058 Yars1 Rat N-methyl-4-phenylpyridinium increases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in increased expression of YARS1 mRNA CTD PMID:28801915 Yars1 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of YARS1 mRNA CTD PMID:24136188 Yars1 Rat nickel atom increases expression ISO YARS1 (Homo sapiens) 6480464 Nickel results in increased expression of YARS1 mRNA CTD PMID:24768652 Yars1 Rat ochratoxin A increases methylation ISO YARS1 (Homo sapiens) 6480464 ochratoxin A results in increased methylation of YARS1 promoter CTD PMID:30559759 Yars1 Rat ochratoxin A decreases expression ISO YARS1 (Homo sapiens) 6480464 ochratoxin A results in decreased expression of YARS1 mRNA CTD PMID:30559759 Yars1 Rat p-chloromercuribenzoic acid increases expression ISO YARS1 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in increased expression of YARS1 mRNA CTD PMID:26272509 Yars1 Rat p-chloromercuribenzoic acid multiple interactions ISO YARS1 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of YARS1 mRNA CTD PMID:27188386 Yars1 Rat paracetamol decreases expression ISO YARS1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of YARS1 mRNA CTD PMID:25596134 Yars1 Rat paracetamol affects expression ISO Yars1 (Mus musculus) 6480464 Acetaminophen affects the expression of YARS1 mRNA CTD PMID:17562736 Yars1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of YARS1 mRNA CTD PMID:32479839 Yars1 Rat paracetamol increases expression ISO YARS1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of YARS1 mRNA CTD PMID:29067470 Yars1 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of YARS1 mRNA CTD PMID:32680482 Yars1 Rat perfluorononanoic acid increases expression ISO YARS1 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in increased expression of YARS1 mRNA CTD PMID:32588087 Yars1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Yars1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of YARS1 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of YARS1 mRNA CTD PMID:36331819 Yars1 Rat perfluorooctane-1-sulfonic acid increases expression ISO YARS1 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in increased expression of YARS1 mRNA CTD PMID:32588087 and PMID:36864359 Yars1 Rat perfluorooctanoic acid increases expression ISO YARS1 (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of YARS1 mRNA and perfluorooctanoic acid results in increased expression of YARS1 protein CTD PMID:26879310 more ... Yars1 Rat phenobarbital increases expression ISO YARS1 (Homo sapiens) 6480464 Phenobarbital results in increased expression of YARS1 mRNA CTD PMID:19084549 Yars1 Rat phenobarbital affects expression ISO YARS1 (Homo sapiens) 6480464 Phenobarbital affects the expression of YARS1 mRNA CTD PMID:19159669 Yars1 Rat phenylmercury acetate increases expression ISO YARS1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of YARS1 mRNA CTD PMID:26272509 Yars1 Rat phenylmercury acetate multiple interactions ISO YARS1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of YARS1 mRNA CTD PMID:27188386 Yars1 Rat phorone affects expression EXP 6480464 phorone affects the expression of YARS1 mRNA CTD PMID:18198479 Yars1 Rat potassium chromate multiple interactions ISO YARS1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of YARS1 mRNA CTD PMID:22079256 Yars1 Rat potassium chromate increases expression ISO YARS1 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of YARS1 mRNA CTD PMID:22079256 Yars1 Rat resveratrol multiple interactions ISO Yars1 (Mus musculus) 6480464 1-(4-dimethylaminomethylphenyl)-8 more ... CTD PMID:25533949 Yars1 Rat resveratrol multiple interactions ISO YARS1 (Homo sapiens) 6480464 [Resveratrol promotes the reaction [PARP1 protein binds to YARS1 protein]] which results in increased ADP-ribosylation of PARP1 protein more ... CTD PMID:25533949 Yars1 Rat resveratrol affects localization ISO YARS1 (Homo sapiens) 6480464 Resveratrol affects the localization of YARS1 protein CTD PMID:25533949 Yars1 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of YARS1 protein CTD PMID:35544339 Yars1 Rat S-(1,2-dichlorovinyl)-L-cysteine increases expression ISO YARS1 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in increased expression of YARS1 mRNA CTD PMID:33725128 Yars1 Rat SB 431542 multiple interactions ISO YARS1 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Yars1 Rat sodium arsenite increases expression ISO YARS1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of YARS1 mRNA CTD PMID:38568856 Yars1 Rat sodium arsenite multiple interactions ISO YARS1 (Homo sapiens) 6480464 sodium arsenite promotes the reaction [YARS1 protein binds to CAPRIN1 protein] CTD PMID:33939924 Yars1 Rat sodium chloride multiple interactions ISO YARS1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of YARS1 protein more ... CTD PMID:38598786 Yars1 Rat sulforaphane multiple interactions ISO Yars1 (Mus musculus) 6480464 [sulforaphane affects the susceptibility to Oxygen] which affects the expression of YARS1 mRNA CTD PMID:30529165 Yars1 Rat sunitinib increases expression ISO YARS1 (Homo sapiens) 6480464 Sunitinib results in increased expression of YARS1 mRNA CTD PMID:31533062 Yars1 Rat tanespimycin multiple interactions ISO YARS1 (Homo sapiens) 6480464 [tanespimycin co-treated with VER 155008] results in decreased expression of YARS1 protein CTD PMID:31370342 Yars1 Rat tetrachloroethene increases expression ISO Yars1 (Mus musculus) 6480464 Tetrachloroethylene results in increased expression of YARS1 mRNA CTD PMID:28973375 Yars1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of YARS1 mRNA] CTD PMID:31150632 Yars1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of YARS1 mRNA CTD PMID:31150632 Yars1 Rat thapsigargin increases expression ISO YARS1 (Homo sapiens) 6480464 Thapsigargin results in increased expression of YARS1 mRNA and Thapsigargin results in increased expression of YARS1 protein CTD PMID:22378314 and PMID:29453283 Yars1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of YARS1 mRNA CTD PMID:34492290 Yars1 Rat thiram increases expression ISO YARS1 (Homo sapiens) 6480464 Thiram results in increased expression of YARS1 mRNA CTD PMID:38568856 Yars1 Rat titanium dioxide decreases methylation ISO Yars1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of YARS gene and titanium dioxide results in decreased methylation of YARS promoter alternative form CTD PMID:35295148 Yars1 Rat tolcapone increases expression EXP 6480464 Tolcapone results in increased expression of YARS1 mRNA CTD PMID:24136188 Yars1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of YARS1 mRNA CTD PMID:33387578 Yars1 Rat troglitazone decreases expression EXP 6480464 Troglitazone results in decreased expression of YARS1 mRNA CTD PMID:25596134 Yars1 Rat trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of YARS1 mRNA CTD PMID:24136188 Yars1 Rat tunicamycin increases expression ISO YARS1 (Homo sapiens) 6480464 Tunicamycin results in increased expression of YARS1 mRNA and Tunicamycin results in increased expression of YARS1 protein CTD PMID:22378314 and PMID:29453283 Yars1 Rat valproic acid decreases methylation ISO YARS1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of YARS1 gene CTD PMID:29154799 Yars1 Rat valproic acid affects expression ISO Yars1 (Mus musculus) 6480464 Valproic Acid affects the expression of YARS1 mRNA CTD PMID:17292431 Yars1 Rat valproic acid increases expression ISO YARS1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of YARS1 mRNA CTD PMID:23179753 Yars1 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of YARS1 mRNA CTD PMID:22570695 Yars1 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of YARS1 mRNA CTD PMID:23034163 Yars1 Rat zidovudine multiple interactions ISO YARS1 (Homo sapiens) 6480464 [Zidovudine co-treated with Lamivudine] results in increased expression of YARS1 mRNA CTD PMID:15784690 Yars1 Rat zoledronic acid decreases expression ISO YARS1 (Homo sapiens) 6480464 Zoledronic Acid results in decreased expression of YARS1 mRNA CTD PMID:25596134
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) (-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dichloroethane (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 2-palmitoylglycerol (ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-amino-2,6-dinitrotoluene (EXP) 5-fluorouracil (ISO) acrylamide (ISO) adefovir pivoxil (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) AM-251 (ISO) aristolochic acid A (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) Brodifacoum (EXP) buspirone (EXP) butan-1-ol (ISO) cadmium dichloride (ISO) carbamazepine (ISO) CGP 52608 (ISO) chloroacetaldehyde (ISO) chloropicrin (ISO) cidofovir anhydrous (ISO) cisplatin (ISO) clodronic acid (ISO) clofibrate (EXP) copper(II) sulfate (ISO) cyclosporin A (EXP,ISO) DDE (ISO) dexamethasone (ISO) dioxygen (ISO) dorsomorphin (ISO) endosulfan (EXP) enzyme inhibitor (ISO) epoxiconazole (ISO) fenofibrate (EXP,ISO) flutamide (EXP) furfural (ISO) gentamycin (EXP) glafenine (EXP) hyaluronic acid (EXP) hydrogen peroxide (EXP) ibuprofen (ISO) indometacin (ISO) ivermectin (ISO) lamivudine (ISO) lead diacetate (EXP) leflunomide (ISO) mercury dibromide (ISO) mercury dichloride (EXP) metformin (EXP) methylmercury chloride (ISO) N(4)-hydroxycytidine (ISO) N-methyl-4-phenylpyridinium (EXP,ISO) nefazodone (EXP) nickel atom (ISO) ochratoxin A (ISO) p-chloromercuribenzoic acid (ISO) paracetamol (EXP,ISO) paraquat (EXP) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) phorone (EXP) potassium chromate (ISO) resveratrol (ISO) rotenone (EXP) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) sodium arsenite (ISO) sodium chloride (ISO) sulforaphane (ISO) sunitinib (ISO) tanespimycin (ISO) tetrachloroethene (ISO) tetrachloromethane (EXP) thapsigargin (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) tolcapone (EXP) trichloroethene (EXP) troglitazone (EXP) trovafloxacin (EXP) tunicamycin (ISO) valproic acid (ISO) vinclozolin (EXP) zidovudine (ISO) zoledronic acid (ISO)
Yars1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 146,820,163 - 146,848,377 (+) NCBI GRCr8 mRatBN7.2 5 141,535,815 - 141,564,029 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 141,535,759 - 141,563,833 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 144,233,688 - 144,262,170 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 146,003,509 - 146,031,990 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 146,003,105 - 146,031,352 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 147,375,350 - 147,403,578 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 147,375,350 - 147,403,571 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 151,109,967 - 151,138,479 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 148,350,363 - 148,378,989 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 148,360,401 - 148,389,028 (+) NCBI Celera 5 140,015,592 - 140,043,428 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
YARS1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 32,775,239 - 32,817,358 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 32,775,237 - 32,818,031 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 33,240,840 - 33,282,959 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 33,013,427 - 33,056,220 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 32,909,932 - 32,952,726 NCBI Celera 1 31,509,662 - 31,552,283 (-) NCBI Celera Cytogenetic Map 1 p35.1 NCBI HuRef 1 31,356,139 - 31,399,200 (-) NCBI HuRef CHM1_1 1 33,356,247 - 33,399,028 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 32,635,023 - 32,677,140 (-) NCBI T2T-CHM13v2.0
Yars1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 129,083,595 - 129,113,033 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 129,083,553 - 129,113,400 (+) Ensembl GRCm39 Ensembl GRCm38 4 129,189,734 - 129,219,240 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 129,189,760 - 129,219,607 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 128,867,039 - 128,896,851 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 128,692,255 - 128,721,911 (+) NCBI MGSCv36 mm8 Celera 4 127,529,758 - 127,559,623 (+) NCBI Celera Cytogenetic Map 4 D2.2 NCBI cM Map 4 63.05 NCBI
Yars1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955452 11,046,047 - 11,078,016 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955452 11,046,047 - 11,078,016 (-) NCBI ChiLan1.0 ChiLan1.0
YARS1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 194,004,825 - 194,044,614 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 193,126,810 - 193,166,838 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 32,068,202 - 32,108,664 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 33,232,163 - 33,295,347 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 33,232,905 - 33,294,558 (-) Ensembl panpan1.1 panPan2
YARS1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 68,535,402 - 68,566,197 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 68,535,447 - 68,565,439 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 65,115,258 - 65,146,054 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 69,100,498 - 69,131,463 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 69,100,535 - 69,132,060 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 65,912,002 - 65,942,953 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 66,934,433 - 66,965,241 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 67,926,368 - 67,957,551 (+) NCBI UU_Cfam_GSD_1.0
Yars1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 49,867,056 - 49,896,532 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 15,691,842 - 15,721,953 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 15,691,838 - 15,721,308 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
YARS1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 89,088,544 - 89,119,592 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 89,088,122 - 89,118,837 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 83,115,016 - 83,145,732 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
YARS1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 100,050,717 - 100,096,719 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 100,052,535 - 100,095,980 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 16,595,637 - 16,639,571 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Yars1
.
Predicted Target Of
Count of predictions: 83 Count of miRNA genes: 63 Interacting mature miRNAs: 77 Transcripts: ENSRNOT00000010674 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 631562 Apr2 Acute phase response QTL 2 3.7 blood murinoglobulin 1 amount (VT:0010597) plasma murinoglobulin 1 level (CMO:0001931) 5 135927956 166875058 Rat 61444 Strs2 Sensitivity to stroke QTL 2 4.7 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 5 135929696 166875058 Rat 61452 Ciaa5 CIA Autoantibody QTL 5 3.5 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 5 94858972 143070159 Rat 70156 Niddm30 Non-insulin dependent diabetes mellitus QTL 30 3.98 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 5 129132447 151006154 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 1331803 Rf32 Renal function QTL 32 2.798 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 129132428 143070159 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1581510 Cm54 Cardiac mass QTL 54 3.4 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 5 120740824 143608494 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 2293642 Bss37 Bone structure and strength QTL 37 4.64 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 120740824 151018848 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
D5Rat97
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 5 146,838,530 - 146,838,760 (+) Marker Load Pipeline mRatBN7.2 5 141,554,182 - 141,554,412 (+) MAPPER mRatBN7.2 Rnor_6.0 5 147,393,732 - 147,393,961 NCBI Rnor6.0 Rnor_5.0 5 151,128,633 - 151,128,862 UniSTS Rnor5.0 RGSC_v3.4 5 148,369,142 - 148,369,372 RGD RGSC3.4 RGSC_v3.4 5 148,369,143 - 148,369,372 UniSTS RGSC3.4 RGSC_v3.1 5 148,379,182 - 148,379,411 RGD Celera 5 140,033,582 - 140,033,811 UniSTS RH 3.4 Map 5 958.0 RGD RH 3.4 Map 5 958.0 UniSTS RH 2.0 Map 5 163.9 RGD SHRSP x BN Map 5 79.6799 RGD FHH x ACI Map 5 78.8 RGD Cytogenetic Map 5 q36 UniSTS
RH130408
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 141,563,717 - 141,563,922 (+) MAPPER mRatBN7.2 Rnor_6.0 5 147,403,267 - 147,403,471 NCBI Rnor6.0 Rnor_5.0 5 151,138,168 - 151,138,372 UniSTS Rnor5.0 RGSC_v3.4 5 148,378,678 - 148,378,882 UniSTS RGSC3.4 Celera 5 140,043,117 - 140,043,321 UniSTS Cytogenetic Map 5 q36 UniSTS
RH142596
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 141,536,271 - 141,536,381 (+) MAPPER mRatBN7.2 Rnor_6.0 5 147,375,807 - 147,375,916 NCBI Rnor6.0 Rnor_5.0 5 151,110,424 - 151,110,533 UniSTS Rnor5.0 RGSC_v3.4 5 148,350,820 - 148,350,929 UniSTS RGSC3.4 Celera 5 140,016,049 - 140,016,158 UniSTS RH 3.4 Map 5 957.6 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000010674 ⟹ ENSRNOP00000010674
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 141,535,759 - 141,563,833 (+) Ensembl Rnor_6.0 Ensembl 5 147,375,350 - 147,403,571 (+) Ensembl
RefSeq Acc Id:
NM_001025696 ⟹ NP_001020867
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 146,820,163 - 146,848,377 (+) NCBI mRatBN7.2 5 141,535,815 - 141,564,029 (+) NCBI Rnor_6.0 5 147,375,350 - 147,403,578 (+) NCBI Rnor_5.0 5 151,109,967 - 151,138,479 (+) NCBI RGSC_v3.4 5 148,350,363 - 148,378,989 (+) RGD Celera 5 140,015,592 - 140,043,428 (+) RGD
Sequence:
GAGGATCTAGGCCTATCAAGCGGAGCTACGAGCTCAGCTGATGCAACCTGACGGGACTAGCGTGACAGTTCCCGGCACGCGGAGACGGCGGCGAACGAGGAAAGGGCGCGGGTGCCGGCTGAGCGCGG
hide sequence
RefSeq Acc Id:
NP_001020867 ⟸ NM_001025696
- UniProtKB:
Q4KM49 (UniProtKB/Swiss-Prot), A6ISH9 (UniProtKB/TrEMBL)
- Sequence:
MQPDGTSVTVPGTRRRRRTRKGRGCRLSAGNRESGAMGDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKVYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLEL
hide sequence
Ensembl Acc Id:
ENSRNOP00000010674 ⟸ ENSRNOT00000010674
RGD ID: 13694057 Promoter ID: EPDNEW_R4582 Type: initiation region Name: Yars_1 Description: tyrosyl-tRNA synthetase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 147,375,385 - 147,375,445 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-08-08
Yars1
tyrosyl-tRNA synthetase 1
Yars
tyrosyl-tRNA synthetase
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Yars
tyrosyl-tRNA synthetase
Yars_predicted
tyrosyl-tRNA synthetase (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Yars_predicted
tyrosyl-tRNA synthetase (predicted)
Symbol and Name status set to approved
70820 APPROVED
