Advanced Search (OLGA)

Gene: Cd302 (CD302 molecule) Rattus norvegicus

Analyze

Symbol:

Cd302

Name:

CD302 molecule

RGD ID:

1307606

Description:

Predicted to enable signaling receptor activity. Predicted to act upstream of or within phagocytosis. Predicted to be located in cell cortex and filopodium. Orthologous to human CD302 (CD302 molecule); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

C-type lectin domain family 13 member A; CD302 antigen; LOC295629; MGC108799; RGD1307606; similar to RIKEN cDNA 1110055L24; type I transmembrane C-type lectin receptor DCL-1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CD302 (CD302 molecule)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL
Mus musculus (house mouse):	Cd302 (CD302 antigen)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CD302 (CD302 molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CD302 (CD302 molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CD302 (CD302 molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	CD302 (CD302 molecule)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cd302 (CD302 antigen)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cd302 (CD302 molecule)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB)
Danio rerio (zebrafish):	cd302 (CD302 molecule)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cd302	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	65,131,017 - 65,164,737 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	65,113,102 - 65,164,737 (-)	Ensembl				GRCr8
mRatBN7.2	3	44,722,324 - 44,756,045 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	44,722,325 - 44,756,045 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	48,083,413 - 48,117,107 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	56,666,985 - 56,700,674 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	54,432,113 - 54,465,827 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	46,327,382 - 46,361,092 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	46,327,383 - 46,361,092 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	51,435,506 - 51,469,216 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	41,958,036 - 41,991,705 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	42,764,963 - 42,798,643 (-)	NCBI		Celera
RGSC_v3.1	3	41,854,408 - 41,888,077 (-)	NCBI
Cytogenetic Map	3	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

3-chloropropane-1,2-diol (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin B1 (ISO)

alpha-Zearalanol (EXP)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bilirubin IXalpha (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butyric acid (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

cisplatin (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

diuron (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

entinostat (ISO)

epoxiconazole (ISO)

ethyl methanesulfonate (ISO)

fipronil (EXP)

flutamide (EXP)

folic acid (ISO)

fonofos (ISO)

formaldehyde (ISO)

gentamycin (EXP)

indometacin (ISO)

isoprenaline (ISO)

levofloxacin (EXP)

methapyrilene (EXP)

methotrexate (ISO)

methyl methanesulfonate (ISO)

N-ethyl-N-nitrosourea (ISO)

nefazodone (EXP)

okadaic acid (ISO)

ozone (ISO)

paracetamol (ISO)

parathion (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phorbol 13-acetate 12-myristate (ISO)

progesterone (ISO)

quercetin (ISO)

quercitrin (ISO)

rotenone (EXP)

S-nitrosoglutathione (ISO)

SB 431542 (ISO)

silicon dioxide (EXP,ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

tamoxifen (ISO)

terbufos (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

phagocytosis (ISO)

Cellular Component

cell cortex (IEA,ISO)

filopodium (IEA,ISO)

membrane (IEA)

microvillus (IEA)

Molecular Function

carbohydrate binding (IEA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:15489334	PMID:17947679	PMID:19946888

Genomics

Comparative Map Data

Cd302
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	65,131,017 - 65,164,737 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	65,113,102 - 65,164,737 (-)	Ensembl				GRCr8
mRatBN7.2	3	44,722,324 - 44,756,045 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	44,722,325 - 44,756,045 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	48,083,413 - 48,117,107 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	56,666,985 - 56,700,674 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	54,432,113 - 54,465,827 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	46,327,382 - 46,361,092 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	46,327,383 - 46,361,092 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	51,435,506 - 51,469,216 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	41,958,036 - 41,991,705 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	42,764,963 - 42,798,643 (-)	NCBI		Celera
RGSC_v3.1	3	41,854,408 - 41,888,077 (-)	NCBI
Cytogenetic Map	3	q21	NCBI

CD302
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	159,768,628 - 159,798,208 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	159,768,628 - 159,798,255 (-)	Ensembl			hg38	GRCh38
GRCh37	2	160,625,139 - 160,654,719 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	160,333,610 - 160,362,999 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	2	160,450,870 - 160,480,260	NCBI
Celera	2	154,236,985 - 154,266,601 (-)	NCBI		Celera
Cytogenetic Map	2	q24.2	NCBI
HuRef	2	152,509,042 - 152,537,708 (-)	NCBI		HuRef
CHM1_1	2	160,631,512 - 160,661,120 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	160,225,996 - 160,255,550 (-)	NCBI		T2T-CHM13v2.0

Cd302
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	60,082,337 - 60,114,828 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	60,082,337 - 60,114,832 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	2	60,251,993 - 60,284,484 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	60,251,993 - 60,284,488 (-)	Ensembl			mm10	GRCm38
MGSCv37	2	60,090,050 - 60,122,475 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	2	60,052,832 - 60,085,257 (-)	NCBI		MGSCv36	mm8
Celera	2	61,947,125 - 61,978,864 (-)	NCBI		Celera
Cytogenetic Map	2	C1.1	NCBI
cM Map	2	34.5	NCBI

CD302
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	62,459,405 - 62,489,537 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	62,474,381 - 62,504,485 (-)	NCBI		NHGRI_mPanPan1
PanPan1.1 Ensembl	2B	164,436,173 - 164,462,508 (-)	Ensembl			panPan2	panpan1.1

CD302
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	66,696,775 - 66,732,605 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	15	66,701,634 - 66,732,590 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	73,935,373 - 73,968,259 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CD302
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Vero_WHO_p1.0	NW_023666040	154,389,025 - 154,403,504 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Cd302
261 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	148
Count of miRNA genes:	110
Interacting mature miRNAs:	124
Transcripts:	ENSRNOT00000008987
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10401810	Kidm53	Kidney mass QTL 53			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	28625339	67641995	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	35403199	97383526	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	58601291	153936591	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	49872657	138829559	Rat
631832	Sach1	Saccharin preference QTL 1	2.7	0.02	consumption behavior trait (VT:0002069)	calculated saccharin drink intake volume (CMO:0001600)	3	47904172	92904172	Rat
9590286	Uminl1	Urine mineral level QTL 1	3.5	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	3	48657744	93657744	Rat
10450816	Scl75	Serum cholesterol level QTL 75	4.4	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	58601291	71157804	Rat
4889966	Bss95	Bone structure and strength QTL 95	4.4		tibia area (VT:1000281)	tibia-fibula cross-sectional area (CMO:0001718)	3	37796919	82796919	Rat
2313093	Bmd77	Bone mineral density QTL 77	2.2	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	3	47904172	70710963	Rat
12879852	Cm93	Cardiac mass QTL 93		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	38708931	67641995	Rat
12879853	Am5	Aortic mass QTL 5		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	38708931	67641995	Rat
12879854	Kidm63	Kidney mass QTL 63		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	38708931	67641995	Rat
61356	Bp37	Blood pressure QTL 37	3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	3	51092561	96092561	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	36721849	110333156	Rat
12879849	Bw180	Body weight QTL 180		0.037	body mass (VT:0001259)	body weight (CMO:0000012)	3	38708931	67641995	Rat
2313101	Bmd76	Bone mineral density QTL 76	3.6	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	3	47904172	70710963	Rat
12879850	Cm91	Cardiac mass QTL 91		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	38708931	67641995	Rat
731172	Bp151	Blood pressure QTL 151		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	38708931	67641995	Rat
12879851	Cm92	Cardiac mass QTL 92		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	38708931	67641995	Rat
8694196	Abfw2	Abdominal fat weight QTL 2	16.58	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	3	48657744	93657744	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	1	141509147	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	36101403	81101403	Rat
10450852	Stl33	Serum triglyceride level QTL 33	3.4	0.05	blood LDL triglyceride amount (VT:0010699)	blood lipoprotein triglyceride level (CMO:0002685)	3	58601291	71157804	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	5675975	141509147	Rat
4889975	Bmd81	Bone mineral density QTL 81	4.3		tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	3	59119402	70710963	Rat
1300178	Hrtrt4	Heart rate QTL 4	3.74		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	51490129	111359995	Rat
634317	Bw117	Body weight QTL 117	3.58		abdominal fat pad mass (VT:1000711)	abdominal fat pad weight to body weight ratio (CMO:0000095)	3	59863663	73704481	Rat
1331795	Rf30	Renal function QTL 30	3.708		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	3	59863663	87321459	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	51581665	184004958	Rat
1354589	Bw31	Body weight QTL 31	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	53651826	98651826	Rat
2303593	Gluco46	Glucose level QTL 46	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	48876619	93876619	Rat
1354590	Despr11	Despair related QTL 11		0.000031	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	3	48876619	93876619	Rat
2313079	Bss73	Bone structure and strength QTL 73	1.5		tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	3	47904172	70710963	Rat
1331777	Bw24	Body weight QTL 24	3.503		body mass (VT:0001259)	body weight (CMO:0000012)	3	59863663	87321459	Rat
631647	Bp122	Blood pressure QTL 122	6.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	51092561	96092561	Rat
2313076	Bss74	Bone structure and strength QTL 74	2	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	3	47904172	70710963	Rat
1300169	Bp177	Blood pressure QTL 177	2.96		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	3	36425116	81425116	Rat
10450813	Scl74	Serum cholesterol level QTL 74	5.8	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	58601291	71157804	Rat
2302276	Bw82	Body weight QTL 82	4.32		body mass (VT:0001259)	body weight (CMO:0000012)	3	59863663	83358329	Rat
738019	Anxrr10	Anxiety related response QTL 10	3.9		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	3	58925062	103925062	Rat
9590136	Scort3	Serum corticosterone level QTL 3	23.37	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	48657744	93657744	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	50766145	95766145	Rat
1558650	Cm48	Cardiac mass QTL 48	4	0.0001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	3	50766145	95766145	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	42158111	124558371	Rat
2325840	Bp345	Blood pressure QTL 345		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	38708931	83708931	Rat
8552950	Pigfal12	Plasma insulin-like growth factor 1 level QTL 12	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	48657744	93657744	Rat
631676	Cm8	Cardiac mass QTL 8	7.03	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	3	37363734	82363734	Rat
8694386	Bw159	Body weight QTL 159	4.52	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	3	48657744	93657744	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	42158111	124558371	Rat
2313049	Bss72	Bone structure and strength QTL 72	2.6	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	3	47904172	70710963	Rat

Markers in Region

RH137331

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	3	65,131,088 - 65,131,293 (+)	Marker Load Pipeline
mRatBN7.2	3	44,722,395 - 44,722,600 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	46,327,454 - 46,327,658	NCBI	Rnor6.0
Rnor_5.0	3	51,435,578 - 51,435,782	UniSTS	Rnor5.0
RGSC_v3.4	3	41,958,108 - 41,958,312	UniSTS	RGSC3.4
Celera	3	42,765,035 - 42,765,239	UniSTS
RH 3.4 Map	18	368.1	UniSTS
Cytogenetic Map	3	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	164	91	90	59	92	59	6	356	192	11	143	81	92	31	16	16

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001013916	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC089829	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473983	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209402	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212863	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213169	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215218	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216383	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219212	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219294	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219651	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219714	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000008987 ⟹ ENSRNOP00000008987

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	65,131,018 - 65,164,737 (-)	Ensembl
mRatBN7.2 Ensembl	3	44,722,325 - 44,756,045 (-)	Ensembl
Rnor_6.0 Ensembl	3	46,327,383 - 46,361,092 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000106977 ⟹ ENSRNOP00000077037

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	65,131,018 - 65,160,935 (-)	Ensembl
mRatBN7.2 Ensembl	3	44,722,325 - 44,752,343 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112941 ⟹ ENSRNOP00000082148

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	65,113,102 - 65,164,737 (-)	Ensembl
mRatBN7.2 Ensembl	3	44,722,612 - 44,756,045 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000115034 ⟹ ENSRNOP00000097098

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	65,131,018 - 65,152,697 (-)	Ensembl
mRatBN7.2 Ensembl	3	44,722,325 - 44,744,004 (-)	Ensembl

RefSeq Acc Id:

NM_001013916 ⟹ NP_001013938

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	65,131,017 - 65,164,737 (-)	NCBI
mRatBN7.2	3	44,722,324 - 44,756,045 (-)	NCBI
Rnor_6.0	3	46,327,382 - 46,361,092 (-)	NCBI
Rnor_5.0	3	51,435,506 - 51,469,216 (-)	NCBI
RGSC_v3.4	3	41,958,036 - 41,991,705 (-)	RGD
Celera	3	42,764,963 - 42,798,643 (-)	RGD

Sequence:

show sequence

TTTTGCAACATTTTAGAAAGTCTGAGATTATTTCAGTTCAAATGGAAAGTTTATCTTTAACGGA
GAGAAGTTGGAGTCTGCGGCTTGCCAGCCCTTTGGGGATCTGAGCGTCCAAGCAGTGCGACCCT
GGGCTCCACTCCCCCGCCTCGAGTGGGAGGCGTCGCGACTGAGCTGGGAGCTCCGCGCGGCCGA
CAAGCACCGCCCCCGGCCCGCTCTCCGCACAGCACCTCGCAGTCATGCCCCACGCAGCGCTATC
CTCGCTCGTGCTGCTGAGCCTAGCCACTGCCATCTTCGCTGACTGTCCTTCGTCCATCTGGGTT
CAGTTCCAAGGCAGCTGTTACACTTTTCTTCAAGTAACCATCAATGTGGAAAACATAGAGGATG
TCAGAAAGCAGTGTACTGATCACGGGGCAGACCTGGTAAGTATACACAATGAAGAAGAAAACGC
ATTTATACTGGACACTTTACAAAAGCGATGGAAAGGCCCGGATGATCTTCTGCTAGGCATGTTT
TATGACACTGATGATGCAAGTTTCAAGTGGTTTGATCAGTCAAATATGACATTCGACAAGTGGG
CAGATGAGGATGGTGAGGACCTAGTTGACACCTGTGGTTTTCTGTATGCCAAGACAGGTGAATG
GAGAAAAGGAAATTGTGAAATGTCTTCTGTGACAGGAACACTTTGCAAAACAGCAATCCCATAT
GACAAGAAGTATTTATCAGATAACCACATTTTAATATCGACTCTGGTGATCGCTAGCACAGTGA
CTCTGGCAGTTTTGGGAGCGGTCATTTGGTTCCTCTATAGAAGGAGCGCACGCTCTGGCTTCAC
CTCTTTCTCTCCTGCACCACAATCACCTTACAGTGATGGCTGTGCTCTGGTAGTTTCGGAAGAA
GATGAATACTCTGTTCAGCTGGACTGAGAGTTTGGGAACATCAGACGAGCACACTGAACACCTT
GACAAGAAATAATTTCCTATGCAAGATTGTCATGTAAAATTTGCCACGGAAAACTGAACCTTTT
ATGGTATTCCTTATTCTTCTAACAATATTTTCATGTATTCAATGTGACAAAACATAAACCTTCT
GATTAAAAGGAAAAAAAGTAGGTTTCAGAAAAGGAACCAGCACAGAGCTAACTTACAGGTTTTC
TTAAGTAGTTTTCATTTGAGTAAATGAAAGCTACAGTACAATAAAGCTGGTAAAACGCAAAAAA
AAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001013938	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH89829	(Get FASTA)	NCBI Sequence Viewer
	EDM00381	(Get FASTA)	NCBI Sequence Viewer
	EDM00382	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000008987
	ENSRNOP00000008987.6
GenBank Protein	Q5FVR3	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001013938 ⟸ NM_001013916
- Peptide Label:	precursor
- UniProtKB:	Q5FVR3 (UniProtKB/Swiss-Prot), F1LQ10 (UniProtKB/TrEMBL)
- Sequence:	show sequence MPHAALSSLVLLSLATAIFADCPSSIWVQFQGSCYTFLQVTINVENIEDVRKQCTDHGADLVSI HNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDASFKWFDQSNMTFDKWADEDGEDLVDTCGFL YAKTGEWRKGNCEMSSVTGTLCKTAIPYDKKYLSDNHILISTLVIASTVTLAVLGAVIWFLYRR SARSGFTSFSPAPQSPYSDGCALVVSEEDEYSVQLD hide sequence

Ensembl Acc Id:

ENSRNOP00000008987 ⟸ ENSRNOT00000008987

Ensembl Acc Id:

ENSRNOP00000077037 ⟸ ENSRNOT00000106977

Ensembl Acc Id:

ENSRNOP00000082148 ⟸ ENSRNOT00000112941

Ensembl Acc Id:

ENSRNOP00000097098 ⟸ ENSRNOT00000115034

Protein Domains

C-type lectin

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5FVR3-F1-model_v2	AlphaFold	Q5FVR3	1-228	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692090

Promoter ID:

EPDNEW_R2615

Type:

initiation region

Name:

Cd302_1

Description:

CD302 molecule

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	46,360,881 - 46,360,941	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307606	AgrOrtholog
BioCyc Gene	G2FUF-49625	BioCyc
Ensembl Genes	ENSRNOG00000006623	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000008987	ENTREZGENE
	ENSRNOT00000008987.6	UniProtKB/Swiss-Prot
Gene3D-CATH	3.10.100.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7322853	IMAGE-MGC_LOAD
InterPro	C-type_lectin-like	UniProtKB/Swiss-Prot
	C-type_lectin-like/link_sf	UniProtKB/Swiss-Prot
	C-type_lectin/snaclec_domain	UniProtKB/Swiss-Prot
	CTDL_fold	UniProtKB/Swiss-Prot
KEGG Report	rno:295629	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:108799	IMAGE-MGC_LOAD
NCBI Gene	295629	ENTREZGENE
PANTHER	MANNOSE, PHOSPHOLIPASE, LECTIN RECEPTOR RELATED	UniProtKB/Swiss-Prot
Pfam	Lectin_C	UniProtKB/Swiss-Prot
PhenoGen	Cd302	PhenoGen
PROSITE	C_TYPE_LECTIN_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000006623	RatGTEx
SMART	CLECT	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF56436	UniProtKB/Swiss-Prot
UniProt	A0A8I5Y5U8_RAT	UniProtKB/TrEMBL
	A0A8I5ZVX3_RAT	UniProtKB/TrEMBL
	A0A8I6ARA5_RAT	UniProtKB/TrEMBL
	A6JF78_RAT	UniProtKB/TrEMBL
	A6JF79_RAT	UniProtKB/TrEMBL
	CD302_RAT	UniProtKB/Swiss-Prot
	F1LQ10	ENTREZGENE, UniProtKB/TrEMBL
	Q5FVR3	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-06-27	Cd302	CD302 molecule	Cd302	CD302 antigen	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Cd302	CD302 antigen	RGD1307606	similar to RIKEN cDNA 1110055L24	Symbol and Name updated	1299863	APPROVED
2005-12-06	RGD1307606	similar to RIKEN cDNA 1110055L24	RGD1307606_predicted	similar to RIKEN cDNA 1110055L24 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1307606_predicted	similar to RIKEN cDNA 1110055L24 (predicted)	LOC295629_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC295629_predicted	similar to RIKEN cDNA 1110055L24 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message