Nkx6-2 (NK6 homeobox 2) - Rat Genome Database

Name: Nkx6-2
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Nkx6-2 (NK6 homeobox 2) Rattus norvegicus

Analyze

Symbol:

Nkx6-2

Name:

NK6 homeobox 2

RGD ID:

1307280

Description:

Predicted to enable DNA-binding transcription repressor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in cell differentiation; regulation of DNA-templated transcription; and regulation of myelination. Predicted to act upstream of or within several processes, including central nervous system myelination; pancreatic A cell differentiation; and regulation of oligodendrocyte differentiation. Predicted to be active in nucleus. Human ortholog(s) of this gene implicated in spastic ataxia 8. Orthologous to human NKX6-2 (NK6 homeobox 2); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-Tetrachlorodibenzofuran; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

homeobox protein Nkx-6.2; LOC309095; NK6 transcription factor related, locus 2; NK6 transcription factor related, locus 2 (Drosophila)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NKX6-2 (NK6 homeobox 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Nkx6-2 (NK6 homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Nkx6-2 (NK6 homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NKX6-2 (NK6 homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NKX6-2 (NK6 homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Nkx6-2 (NK6 homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NKX6-2 (NK6 homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NKX6-2 (NK6 homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Nkx6-2 (NK6 homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	NKX6-1 (NK6 homeobox 1)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	NKX6-2 (NK6 homeobox 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Nkx6-2 (NK6 homeobox 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nkx6.2 (NK6 homeobox 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cog-1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	nkx6-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	203,811,582 - 203,813,122 (-)	NCBI		GRCr8
mRatBN7.2	1	194,380,149 - 194,383,533 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	194,381,975 - 194,383,515 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	202,741,814 - 202,743,354 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	209,875,137 - 209,876,677 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	202,548,893 - 202,550,433 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	211,922,389 - 211,923,929 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	211,922,389 - 211,923,929 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	218,843,804 - 218,847,968 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	199,397,361 - 199,398,901 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	199,547,331 - 199,548,851 (-)	NCBI
Celera	1	192,060,331 - 192,061,871 (-)	NCBI		Celera
Cytogenetic Map	1	q41	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

distal 10q deletion syndrome (ISO)

genetic disease (ISO)

spastic ataxia 8 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

all-trans-retinoic acid (EXP,ISO)

amosite asbestos (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butanal (ISO)

choline (ISO)

crocidolite asbestos (ISO)

Cuprizon (EXP)

emodin (ISO)

folic acid (ISO)

genistein (ISO)

iron dichloride (ISO)

ketamine (EXP)

L-methionine (ISO)

lead diacetate (EXP)

lipopolysaccharide (ISO)

methamphetamine (EXP)

methylmercury chloride (EXP)

N-nitrosodiethylamine (ISO)

quinolin-8-ol (ISO)

SCH 23390 (EXP)

silicon dioxide (ISO)

titanium dioxide (ISO)

triclosan (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell differentiation (IBA)

cell fate commitment (ISO)

central nervous system myelination (ISO)

endocrine pancreas development (ISO)

negative regulation of cell fate commitment (ISO)

negative regulation of DNA-templated transcription (ISS)

negative regulation of oligodendrocyte differentiation (ISO)

negative regulation of transcription by RNA polymerase II (ISO)

neuromuscular process controlling balance (ISO)

neuron fate commitment (ISO)

oligodendrocyte differentiation (ISO)

pancreatic A cell differentiation (ISO)

positive regulation of cell fate commitment (ISO)

positive regulation of oligodendrocyte differentiation (ISO)

regulation of myelination (ISS)

regulation of transcription by RNA polymerase II (IBA,ISO)

Cellular Component

nucleus (IBA,ISO)

Molecular Function

DNA binding (ISS)

DNA-binding transcription factor activity (ISO)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA)

sequence-specific DNA binding (ISO)

sequence-specific double-stranded DNA binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:8096811	PMID:9254678	PMID:10931524	PMID:11567614	PMID:15601927	PMID:15629701	PMID:15629702	PMID:15944193

Genomics

Comparative Map Data

Nkx6-2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	203,811,582 - 203,813,122 (-)	NCBI		GRCr8
mRatBN7.2	1	194,380,149 - 194,383,533 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	194,381,975 - 194,383,515 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	202,741,814 - 202,743,354 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	209,875,137 - 209,876,677 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	202,548,893 - 202,550,433 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	211,922,389 - 211,923,929 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	211,922,389 - 211,923,929 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	218,843,804 - 218,847,968 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	199,397,361 - 199,398,901 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	199,547,331 - 199,548,851 (-)	NCBI
Celera	1	192,060,331 - 192,061,871 (-)	NCBI		Celera
Cytogenetic Map	1	q41	NCBI

NKX6-2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	132,783,181 - 132,786,147 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	132,783,179 - 132,786,147 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	10	134,596,685 - 134,599,651 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	134,448,310 - 134,449,527 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	10	134,448,409 - 134,449,442	NCBI
Celera	10	128,918,129 - 128,919,346 (+)	NCBI		Celera
Cytogenetic Map	10	q26.3	NCBI
HuRef	10	128,149,796 - 128,168,438 (-)	NCBI		HuRef
CHM1_1	10	134,879,801 - 134,881,014 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	10	133,732,363 - 133,735,334 (-)	NCBI		T2T-CHM13v2.0

Nkx6-2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	139,159,292 - 139,162,726 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	139,159,292 - 139,162,713 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	139,579,376 - 139,582,797 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	139,579,376 - 139,582,797 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	146,765,275 - 146,768,696 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	139,430,619 - 139,434,113 (-)	NCBI		MGSCv36	mm8
Celera	7	139,372,632 - 139,376,053 (-)	NCBI		Celera
Cytogenetic Map	7	F4	NCBI
cM Map	7	84.57	NCBI

Nkx6-2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955477	10,386,033 - 10,387,423 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955477	10,386,033 - 10,387,423 (-)	NCBI	ChiLan1.0	ChiLan1.0

NKX6-2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	144,791,002 - 144,792,310 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	144,796,359 - 144,797,667 (-)	NCBI		NHGRI_mPanPan1
PanPan1.1	10	133,682,456 - 133,683,445 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	133,682,456 - 133,683,445 (-)	Ensembl	panpan1.1		panPan2

NKX6-2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	28	40,568,948 - 40,570,240 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	28	40,569,093 - 40,570,793 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	28	40,630,410 - 40,634,025 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	28	41,210,086 - 41,213,421 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	28	41,212,277 - 41,213,389 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	28	40,693,462 - 40,696,832 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	28	40,683,359 - 40,686,533 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	28	41,085,902 - 41,089,237 (-)	NCBI		UU_Cfam_GSD_1.0

Nkx6-2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	6,535,911 - 6,537,217 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936486	19,024,263 - 19,025,390 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936486	19,024,106 - 19,025,387 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NKX6-2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	140,897,874 - 140,899,155 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	140,895,622 - 140,899,114 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	152,868,746 - 152,870,821 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NKX6-2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	125,374,441 - 125,377,565 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	125,376,268 - 125,377,482 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	86,957,160 - 86,960,190 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nkx6-2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624737	14,045,640 - 14,048,786 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624737	14,045,402 - 14,047,005 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Nkx6-2
10 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	112
Count of miRNA genes:	100
Interacting mature miRNAs:	107
Transcripts:	ENSRNOT00000054887
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	177227632	256448636	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
1354653	Despr9	Despair related QTL 9		0.00019	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	167909849	212909849	Rat
2293673	Bss27	Bone structure and strength QTL 27	18.63	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	1	171629477	216629477	Rat
2293677	Bss41	Bone structure and strength QTL 41	9.38	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	1	171629477	216629477	Rat
1302787	Stl25	Serum triglyceride level QTL 25	2.7	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	1	180359209	210702199	Rat
70160	Bw18	Body weight QTL 18	5.7		body mass (VT:0001259)	body weight (CMO:0000012)	1	144267353	196383668	Rat
1549830	Bss1	Bone structure and strength QTL 1	4.8		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	172609619	217609619	Rat
70163	Bw20	Body weight QTL 20	5.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	174133260	219133260	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	179567751	260522016	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	177227632	256448636	Rat
1558658	Bw59	Body weight QTL 59	3.5	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	1	178784622	223784622	Rat
631838	Niddm36	Non-insulin dependent diabetes mellitus QTL 36		0.01	insulin secretion trait (VT:0003564)	calculated pancreatic islet insulin release measurement (CMO:0001217)	1	184550676	229550676	Rat
1354636	Lmblg1	Limb length QTL 1	6.4		tibia length (VT:0004357)	tibia length (CMO:0000450)	1	151162512	201278233	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
2293689	Bss47	Bone structure and strength QTL 47	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	1	171629477	216629477	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	123556856	242907031	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	143506580	212458660	Rat
61341	Bp26	Blood pressure QTL 26			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	169537671	214537671	Rat
1354634	Kidm12	Kidney mass QTL 12	3.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	1	151162512	201278233	Rat
4889428	Stresp24	Stress response QTL 24		0.05	heart pumping trait (VT:2000009)	absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162)	1	155866514	200866514	Rat
2293693	Bss22	Bone structure and strength QTL 22	33.52	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	1	171629477	216629477	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
61343	Bp28	Blood pressure QTL 28			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	151646613	196646613	Rat
152025232	Bw192	Body weight QTL 192	3.93		body mass (VT:0001259)		1	117917486	196963478	Rat
2300161	Bmd43	Bone mineral density QTL 43	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
1300145	Rf7	Renal function QTL 7	2.96		urine creatinine amount (VT:0010540)	urine creatinine level (CMO:0000125)	1	185145134	221264292	Rat
61347	Bp197	Blood pressure QTL 197	4.2		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	1	158633083	203633083	Rat
8655655	Arrd2	Age-related retinal degeneration QTL 2	7.79		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	183970203	243914901	Rat
61348	Bp30	Blood pressure QTL 30	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	144017057	197814409	Rat
2303622	Vencon6	Ventilatory control QTL 6		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	1	154561505	199561505	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	191019702	246062233	Rat
631214	Bw61	Body weight QTL61	3.4	0.0001	intramuscular adipose amount (VT:0010044)	intramuscular fat area (CMO:0001162)	1	173108781	218108781	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	149448574	221264292	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642644	214537671	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118944897	199050459	Rat
2300174	Bmd42	Bone mineral density QTL 42	8.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	1	171629477	216629477	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	144267353	222987745	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	94494440	198211706	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
737977	Bp160	Blood pressure QTL 160		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	181133855	226133855	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	151162766	225824951	Rat
2293654	Bss30	Bone structure and strength QTL 30	32.65	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	1	171629477	216629477	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
2300187	Bmd41	Bone mineral density QTL 41	8.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
8552891	Epfw5	Epididymal fat weight QTL 5	4.4		epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	1	193113876	238113876	Rat
1359018	Hrtrt20	Heart rate QTL 20	3.08		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	185356336	202902618	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	94494440	198324465	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
634312	Bp143	Blood pressure QTL 143	3	0.0002	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	182623426	219932796	Rat
1358294	Bw37	Body weight QTL 37	5	0.000011	body mass (VT:0001259)	body weight (CMO:0000012)	1	171310381	216310381	Rat
61378	Bp43	Blood pressure QTL 43	22.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	181746937	196383668	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
724559	Pancm1	Pancreatic morphology QTL 1	7.1		islet of Langerhans morphology trait (VT:0005215)	pancreatic islet damage composite score (CMO:0001156)	1	181759564	214537555	Rat
2312420	Pur17	Proteinuria QTL 17	7.1	0.0001	urine protein amount (VT:0005160)	urine total protein excretion rate (CMO:0000756)	1	156677124	218753816	Rat
10059600	Bp378	Blood pressure QTL 378	3.08	0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	176869060	221869060	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	102813953	201278233	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
619613	Bp77	Blood pressure QTL 77		0.01	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	164747424	209747424	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
631260	Tcas2	Tongue tumor susceptibility QTL 2	4.93		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	1	192485903	199050587	Rat
619614	Bp78	Blood pressure QTL 78		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	169112897	197261052	Rat
2312564	Glom18	Glomerulus QTL 18	2.4	0.003	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	185356336	231689108	Rat
634321	Hc1	Hypercalciuria QTL 1	2.91		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	178810256	240830002	Rat
724562	Rends1	Renal damage susceptibility QTL 1		0.05	kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	1	169537671	214537671	Rat
2292222	Bp307	Blood pressure QTL 307	3.06	0.0014	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	213533942	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	243914901	Rat
10059590	Kidm44	Kidney mass QTL 44	3.42	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	191033875	236033875	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	102813953	201278233	Rat
1600380	Niddm70	Non-insulin dependent diabetes mellitus QTL 70	3.1	0.0008	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	176550523	221550523	Rat
1582206	Kidm33	Kidney mass QTL 33	6.9		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	188377360	224054420	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1354620	Kidm19	Kidney mass QTL 19	4		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	201278233	Rat
634338	Hcar4	Hepatocarcinoma resistance QTL 4	4.6		liver integrity trait (VT:0010547)	liver tumorous lesion number to liver area ratio (CMO:0001210)	1	193422268	214537671	Rat
8655855	Arrd3	Age-related retinal degeneration QTL 3	3.07		lens clarity trait (VT:0001304)	cataract incidence/prevalence measurement (CMO:0001585)	1	183970203	243914901	Rat
1354618	Kidm15	Kidney mass QTL 15	5		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	1	156677124	201278233	Rat
6480780	Insul18	Insulin level QTL 18	4.11		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	189607473	200611765	Rat
6903303	Scl34	Serum cholesterol QTL 34	2.5	0.0033	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	180359209	218108781	Rat
152025212	Bw190	Body weight QTL 190	5.7		body mass (VT:0001259)		1	123556856	196963478	Rat
631549	Bp89	Blood pressure QTL 89	5.7		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350581	201284552	Rat
2293083	Iddm25	Insulin dependent diabetes mellitus QTL 25	4.18		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	181829673	224569684	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	102813953	218753816	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	176426412	257976495	Rat
1358191	Ept10	Estrogen-induced pituitary tumorigenesis QTL 10	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	192825253	243914732	Rat
1354602	Bw35	Body weight QTL 35	12.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	201278233	Rat
631670	Iddm10	Insulin dependent diabetes mellitus QTL 10	1.9		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	174133260	196383668	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
6	4	11	113	53	51	22	19	22	6	92	50	93	10	55	29

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001107558	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000054887 ⟹ ENSRNOP00000051771

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	194,381,975 - 194,383,515 (-)	Ensembl
Rnor_6.0 Ensembl	1	211,922,389 - 211,923,929 (-)	Ensembl

RefSeq Acc Id:

NM_001107558 ⟹ NP_001101028

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	203,811,582 - 203,813,122 (-)	NCBI
mRatBN7.2	1	194,381,975 - 194,383,515 (-)	NCBI
Rnor_6.0	1	211,922,389 - 211,923,929 (-)	NCBI
Rnor_5.0	1	218,843,804 - 218,847,968 (-)	NCBI
RGSC_v3.4	1	199,397,361 - 199,398,901 (-)	RGD
Celera	1	192,060,331 - 192,061,871 (-)	RGD

Sequence:

show sequence

CACCGCAGCCGCCCCTAATATCCCTGCCTTCTTTCTCTCTGACCGCCGCCCATTCAGCGCAGCA
GCCGTCGGTCCTCTCGCTTTCCCGTGAGGGCCGTCGGCGTCCGCTTGAAACGCGTTACACGCAT
CCCAGTGCAACCGGCGCCCATCGGCGCCGCGCGCAAACTTCCCGAGCCGGCGGGAGCGGGCGGT
GGCAGCGGGGCCCGGATGGGCGCCAGGATCGGAGGCGGCGGCGCCCATGGACGCTAACCGCCCG
GGCGCGTTTGTGCTGAGCAGCGCGCCTTTAGCCGCGCTGCACAACATGGCTGAGATGAAGACGT
CGCTGTTCCCCTACGCGCTGCAGGGCCCGGCGGGCTTCAAGACACCGGCCCTAGGCAGCCTTGG
CGCGCAGTTGCCTCTAGGCACTCCGCACGGCATCAGCGACATCCTGGGACGGCCTGTGGGAGCA
GCGGGTGGCGGCCTCCTGGGAAGTCTGCCCCGTCTCAACGGGCTCGCCTCGTCCGCAGGTGTCT
ACTTCGGGCCCGCAGCTGCGGTGGCTCGGGGCTACCCCAAGCCGCTGGCGGAACTGCCTGGGCG
CCCGCCCATCTTCTGGCCCGGGGTGGTGCAGGGCTCTCCCTGGAGGGACCCGCGCCTGGCCGGC
TCGGCCCAAGCCGGCGGGGTCCTGGATAAGGATGGCAAGAAGAAACACTCGCGGCCGACTTTCT
CTGGCCAGCAGATCTTCGCGCTGGAGAAGACTTTCGAGCAGACCAAGTACTTGGCAGGCCCAGA
GCGCGCGCGGCTTGCCTACTCTCTGGGCATGACCGAGAGCCAGGTGAAGGTGTGGTTCCAGAAT
CGGCGGACCAAGTGGCGCAAGCGGCACGCGGCAGAGATGGCGTCGGCTAAAAAGAAGCAGGACT
CGGATGCCGAGAAGCTGAAGGTGGGTGGCTCAGACGCGGAGGATGATGACGAGTACAACCGGCC
CCTGGACCCCAACTCCGATGACGAGAAGATCACGCGGCTTCTCAAAAAGCACAAACCCTCGAAC
TTGGCGCTTGTTAGCCCGTGTGGCGGCAGCGCGGGGGACGCCTTGTGAGGACGCGGCCAGGCCG
GAGAACCCCGAGAACTGGGACTCGCGGCATACCCCGACGCCAGCCGCCCAGCCGCAGTGTGTAT
ATATATTTTTACAGAATAAGTTATAAAGCGGACGTTGGCGCGGCCTCGGCGTGAGGCGCGGAGT
GCGGGGTTTGGGCCGATCACTTTGTATAATCAATAAATTATTTAACACGTC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001101028	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM11852	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000051771.2

RefSeq Acc Id:

NP_001101028 ⟸ NM_001107558

- UniProtKB:

D3ZZX2 (UniProtKB/TrEMBL), A6HXC1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDANRPGAFVLSSAPLAALHNMAEMKTSLFPYALQGPAGFKTPALGSLGAQLPLGTPHGISDIL
GRPVGAAGGGLLGSLPRLNGLASSAGVYFGPAAAVARGYPKPLAELPGRPPIFWPGVVQGSPWR
DPRLAGSAQAGGVLDKDGKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQV
KVWFQNRRTKWRKRHAAEMASAKKKQDSDAEKLKVGGSDAEDDDEYNRPLDPNSDDEKITRLLK
KHKPSNLALVSPCGGSAGDAL

hide sequence

Ensembl Acc Id:

ENSRNOP00000051771 ⟸ ENSRNOT00000054887

Protein Domains

Homeobox

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZZX2-F1-model_v2	AlphaFold	D3ZZX2	1-277	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307280	AgrOrtholog
BioCyc Gene	G2FUF-57087	BioCyc
Ensembl Genes	ENSRNOG00000017748	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000054887.4	UniProtKB/TrEMBL
Gene3D-CATH	Homeodomain-like	UniProtKB/TrEMBL
InterPro	Homeobox_CS	UniProtKB/TrEMBL
	Homeobox_metazoa	UniProtKB/TrEMBL
	Homeobox_NK-like	UniProtKB/TrEMBL
	Homeodomain	UniProtKB/TrEMBL
	Homeodomain-like	UniProtKB/TrEMBL
	HTH_motif	UniProtKB/TrEMBL
KEGG Report	rno:309095	UniProtKB/TrEMBL
NCBI Gene	309095	ENTREZGENE
PANTHER	HOMEOBOX PROTEIN NKX	UniProtKB/TrEMBL
	HOMEOBOX PROTEIN NKX-6.2	UniProtKB/TrEMBL
Pfam	Homeobox	UniProtKB/TrEMBL
PhenoGen	Nkx6-2	PhenoGen
PRINTS	HOMEOBOX	UniProtKB/TrEMBL
	HTHREPRESSR	UniProtKB/TrEMBL
PROSITE	HOMEOBOX_1	UniProtKB/TrEMBL
	HOMEOBOX_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000017748	RatGTEx
SMART	HOX	UniProtKB/TrEMBL
Superfamily-SCOP	Homeodomain_like	UniProtKB/TrEMBL
UniProt	A6HXC1	ENTREZGENE, UniProtKB/TrEMBL
	D3ZZX2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-09-26	Nkx6-2	NK6 homeobox 2	Nkx6-2	NK6 transcription factor related, locus 2 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Nkx6-2	NK6 transcription factor related, locus 2 (Drosophila)	Nkx6-2_predicted	NK6 transcription factor related, locus 2 (Drosophila) (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Nkx6-2_predicted	NK6 transcription factor related, locus 2 (Drosophila) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM