Symbol:
Nkx6-2
Name:
NK6 homeobox 2
RGD ID:
1307280
Description:
Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in cell differentiation; regulation of DNA-templated transcription; and regulation of myelination. Predicted to act upstream of or within several processes, including central nervous system myelination; pancreatic A cell differentiation; and regulation of oligodendrocyte differentiation. Predicted to be active in nucleus. Human ortholog(s) of this gene implicated in spastic ataxia 8. Orthologous to human NKX6-2 (NK6 homeobox 2); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-Tetrachlorodibenzofuran; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
homeobox protein Nkx-6.2; LOC309095; NK6 transcription factor related, locus 2; NK6 transcription factor related, locus 2 (Drosophila)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NKX6-2 (NK6 homeobox 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Nkx6-2 (NK6 homeobox 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Nkx6-2 (NK6 homeobox 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NKX6-2 (NK6 homeobox 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NKX6-2 (NK6 homeobox 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Nkx6-2 (NK6 homeobox 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NKX6-2 (NK6 homeobox 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NKX6-2 (NK6 homeobox 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Nkx6-2 (NK6 homeobox 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
NKX6-1 (NK6 homeobox 1) HGNC
OrthoDB
Alliance orthologs 3
Homo sapiens (human):
NKX6-2 (NK6 homeobox 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Nkx6-2 (NK6 homeobox 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
nkx6.2 (NK6 homeobox 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
cog-1
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
nkx6-2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 203,811,582 - 203,813,122 (-) NCBI GRCr8 mRatBN7.2 1 194,380,149 - 194,383,533 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 194,381,975 - 194,383,515 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 202,741,814 - 202,743,354 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 209,875,137 - 209,876,677 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 202,548,893 - 202,550,433 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 211,922,389 - 211,923,929 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 211,922,389 - 211,923,929 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 218,843,804 - 218,847,968 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 199,397,361 - 199,398,901 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 199,547,331 - 199,548,851 (-) NCBI Celera 1 192,060,331 - 192,061,871 (-) NCBI Celera Cytogenetic Map 1 q41 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nkx6-2 Rat 17beta-estradiol affects expression ISO NKX6-2 (Homo sapiens) 6480464 Estradiol affects the expression of NKX6-2 mRNA CTD PMID:22574217 Nkx6-2 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:21394737 Nkx6-2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Nkx6-2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of NKX6-2 mRNA CTD PMID:24058054 Nkx6-2 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Nkx6-2 Rat 4,4'-diaminodiphenylmethane increases expression ISO Nkx6-2 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of NKX6-2 mRNA CTD PMID:18648102 Nkx6-2 Rat 4,4'-sulfonyldiphenol decreases expression ISO Nkx6-2 (Mus musculus) 6480464 bisphenol S results in decreased expression of NKX6-2 mRNA CTD PMID:30951980 Nkx6-2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of NKX6-2 mRNA CTD PMID:24780913 and PMID:25825206 Nkx6-2 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of NKX6-2 mRNA CTD PMID:28959563 Nkx6-2 Rat all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of NKX6-2 mRNA CTD PMID:20488242 Nkx6-2 Rat all-trans-retinoic acid increases expression ISO Nkx6-2 (Mus musculus) 6480464 Tretinoin results in increased expression of NKX6-2 mRNA CTD PMID:36189433 Nkx6-2 Rat amosite asbestos decreases methylation ISO NKX6-2 (Homo sapiens) 6480464 Asbestos and Amosite results in decreased methylation of NKX6-2 promoter CTD PMID:29626692 Nkx6-2 Rat benzo[a]pyrene decreases expression ISO Nkx6-2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of NKX6-2 mRNA CTD PMID:27195522 Nkx6-2 Rat benzo[a]pyrene increases methylation ISO NKX6-2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of NKX6-2 promoter CTD PMID:27901495 Nkx6-2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NKX6-2 mRNA CTD PMID:25181051 Nkx6-2 Rat bisphenol A decreases expression ISO Nkx6-2 (Mus musculus) 6480464 bisphenol A results in decreased expression of NKX6-2 mRNA CTD PMID:35598803 Nkx6-2 Rat bisphenol A increases expression ISO Nkx6-2 (Mus musculus) 6480464 bisphenol A results in increased expression of NKX6-2 mRNA CTD PMID:30951980 Nkx6-2 Rat bisphenol F decreases expression ISO Nkx6-2 (Mus musculus) 6480464 bisphenol F results in decreased expression of NKX6-2 mRNA CTD PMID:38685157 Nkx6-2 Rat butanal increases expression ISO NKX6-2 (Homo sapiens) 6480464 butyraldehyde results in increased expression of NKX6-2 mRNA CTD PMID:26079696 Nkx6-2 Rat choline multiple interactions ISO Nkx6-2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of NKX6-2 gene CTD PMID:20938992 Nkx6-2 Rat crocidolite asbestos decreases methylation ISO NKX6-2 (Homo sapiens) 6480464 Asbestos and Crocidolite results in decreased methylation of NKX6-2 promoter CTD PMID:29626692 Nkx6-2 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of NKX6-2 mRNA CTD PMID:26577399 and PMID:27523638 Nkx6-2 Rat emodin increases expression ISO Nkx6-2 (Mus musculus) 6480464 Emodin results in increased expression of NKX6-2 mRNA CTD PMID:15612046 Nkx6-2 Rat folic acid multiple interactions ISO Nkx6-2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of NKX6-2 gene CTD PMID:20938992 Nkx6-2 Rat genistein decreases expression ISO Nkx6-2 (Mus musculus) 6480464 Genistein results in decreased expression of NKX6-2 mRNA CTD PMID:32186404 Nkx6-2 Rat iron dichloride increases expression ISO NKX6-2 (Homo sapiens) 6480464 ferrous chloride results in increased expression of NKX6-2 mRNA CTD PMID:35984750 Nkx6-2 Rat ketamine increases expression EXP 6480464 Ketamine results in increased expression of NKX6-2 mRNA CTD PMID:20080153 Nkx6-2 Rat L-methionine multiple interactions ISO Nkx6-2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of NKX6-2 gene CTD PMID:20938992 Nkx6-2 Rat lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of NKX6-2 mRNA CTD PMID:22641619 Nkx6-2 Rat lipopolysaccharide increases expression ISO Nkx6-2 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of NKX6-2 mRNA CTD PMID:12057914 Nkx6-2 Rat methamphetamine multiple interactions EXP 6480464 [Methamphetamine co-treated with SCH 23390] results in decreased expression of NKX6-2 mRNA CTD PMID:19564919 Nkx6-2 Rat methamphetamine decreases expression EXP 6480464 Methamphetamine results in decreased expression of NKX6-2 mRNA CTD PMID:19564919 Nkx6-2 Rat methylmercury chloride affects expression EXP 6480464 methylmercuric chloride affects the expression of NKX6-2 mRNA CTD PMID:20864626 Nkx6-2 Rat N-nitrosodiethylamine multiple interactions ISO Nkx6-2 (Mus musculus) 6480464 MET protein inhibits the reaction [Diethylnitrosamine results in increased expression of NKX6-2 mRNA] CTD PMID:17942915 Nkx6-2 Rat N-nitrosodiethylamine increases expression ISO Nkx6-2 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of NKX6-2 mRNA CTD PMID:17942915 Nkx6-2 Rat quinolin-8-ol increases expression ISO Nkx6-2 (Mus musculus) 6480464 Oxyquinoline results in increased expression of NKX6-2 mRNA CTD PMID:15612046 Nkx6-2 Rat SCH 23390 multiple interactions EXP 6480464 [Methamphetamine co-treated with SCH 23390] results in decreased expression of NKX6-2 mRNA CTD PMID:19564919 Nkx6-2 Rat silicon dioxide increases expression ISO NKX6-2 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of NKX6-2 mRNA CTD PMID:23806026 Nkx6-2 Rat titanium dioxide decreases expression ISO Nkx6-2 (Mus musculus) 6480464 titanium dioxide results in decreased expression of NKX6-2 mRNA CTD PMID:23557971 Nkx6-2 Rat titanium dioxide increases methylation ISO Nkx6-2 (Mus musculus) 6480464 titanium dioxide results in increased methylation of NKX6-2 gene and titanium dioxide results in increased methylation of NKX6-2 promoter CTD PMID:35295148 Nkx6-2 Rat titanium dioxide decreases methylation ISO Nkx6-2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of NKX6-2 gene and titanium dioxide results in decreased methylation of NKX6-2 promoter CTD PMID:35295148 Nkx6-2 Rat triclosan decreases expression ISO NKX6-2 (Homo sapiens) 6480464 Triclosan results in decreased expression of NKX6-2 mRNA CTD PMID:30510588 Nkx6-2 Rat valproic acid increases methylation ISO NKX6-2 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of NKX6-2 gene CTD PMID:29154799
17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (EXP) all-trans-retinoic acid (EXP,ISO) amosite asbestos (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) butanal (ISO) choline (ISO) crocidolite asbestos (ISO) Cuprizon (EXP) emodin (ISO) folic acid (ISO) genistein (ISO) iron dichloride (ISO) ketamine (EXP) L-methionine (ISO) lead diacetate (EXP) lipopolysaccharide (ISO) methamphetamine (EXP) methylmercury chloride (EXP) N-nitrosodiethylamine (ISO) quinolin-8-ol (ISO) SCH 23390 (EXP) silicon dioxide (ISO) titanium dioxide (ISO) triclosan (ISO) valproic acid (ISO)
Biological Process
cell differentiation (IBA) cell fate commitment (IEA,ISO) central nervous system myelination (IEA,ISO) endocrine pancreas development (IEA,ISO) negative regulation of cell fate commitment (IEA,ISO) negative regulation of DNA-templated transcription (IEA,ISS) negative regulation of oligodendrocyte differentiation (IEA,ISO) negative regulation of transcription by RNA polymerase II (IEA,ISO) neuromuscular process controlling balance (IEA,ISO) neuron fate commitment (IEA,ISO) oligodendrocyte differentiation (IEA,ISO) pancreatic A cell differentiation (IEA,ISO) positive regulation of cell fate commitment (IEA,ISO) positive regulation of oligodendrocyte differentiation (IEA,ISO) regulation of DNA-templated transcription (IEA) regulation of myelination (IEA,ISS) regulation of transcription by RNA polymerase II (IBA,IEA,ISO) spinal cord motor neuron cell fate specification (ISO)
Nkx6-2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 203,811,582 - 203,813,122 (-) NCBI GRCr8 mRatBN7.2 1 194,380,149 - 194,383,533 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 194,381,975 - 194,383,515 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 202,741,814 - 202,743,354 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 209,875,137 - 209,876,677 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 202,548,893 - 202,550,433 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 211,922,389 - 211,923,929 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 211,922,389 - 211,923,929 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 218,843,804 - 218,847,968 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 199,397,361 - 199,398,901 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 199,547,331 - 199,548,851 (-) NCBI Celera 1 192,060,331 - 192,061,871 (-) NCBI Celera Cytogenetic Map 1 q41 NCBI
NKX6-2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 132,783,181 - 132,786,147 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 132,783,179 - 132,786,147 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 134,596,685 - 134,599,651 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 134,448,310 - 134,449,527 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 134,448,409 - 134,449,442 NCBI Celera 10 128,918,129 - 128,919,346 (+) NCBI Celera Cytogenetic Map 10 q26.3 NCBI HuRef 10 128,149,796 - 128,168,438 (-) NCBI HuRef CHM1_1 10 134,879,801 - 134,881,014 (-) NCBI CHM1_1 T2T-CHM13v2.0 10 133,732,363 - 133,735,334 (-) NCBI T2T-CHM13v2.0
Nkx6-2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 139,159,292 - 139,162,726 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 139,159,292 - 139,162,713 (-) Ensembl GRCm39 Ensembl GRCm38 7 139,579,376 - 139,582,797 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 139,579,376 - 139,582,797 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 146,765,275 - 146,768,696 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 139,430,619 - 139,434,113 (-) NCBI MGSCv36 mm8 Celera 7 139,372,632 - 139,376,053 (-) NCBI Celera Cytogenetic Map 7 F4 NCBI cM Map 7 84.57 NCBI
Nkx6-2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955477 10,386,033 - 10,387,423 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955477 10,386,033 - 10,387,423 (-) NCBI ChiLan1.0 ChiLan1.0
NKX6-2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 144,791,002 - 144,792,310 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 144,796,359 - 144,797,667 (-) NCBI NHGRI_mPanPan1 PanPan1.1 10 133,682,456 - 133,683,445 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 133,682,456 - 133,683,445 (-) Ensembl panpan1.1 panPan2
NKX6-2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 28 40,568,948 - 40,570,240 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 28 40,569,093 - 40,570,793 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 28 40,630,410 - 40,634,025 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 28 41,210,086 - 41,213,421 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 28 41,212,277 - 41,213,389 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 28 40,693,462 - 40,696,832 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 28 40,683,359 - 40,686,533 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 28 41,085,902 - 41,089,237 (-) NCBI UU_Cfam_GSD_1.0
Nkx6-2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 6,535,911 - 6,537,217 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936486 19,024,263 - 19,025,390 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936486 19,024,106 - 19,025,387 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NKX6-2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 140,897,874 - 140,899,155 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 140,895,622 - 140,899,114 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 152,868,746 - 152,870,821 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NKX6-2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 125,374,441 - 125,377,565 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 125,376,268 - 125,377,482 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 86,957,160 - 86,960,190 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Nkx6-2
.
Predicted Target Of
Count of predictions: 112 Count of miRNA genes: 100 Interacting mature miRNAs: 107 Transcripts: ENSRNOT00000054887 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1354653 Despr9 Despair related QTL 9 0.00019 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 167909849 212909849 Rat 2293673 Bss27 Bone structure and strength QTL 27 18.63 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 1 171629477 216629477 Rat 2293677 Bss41 Bone structure and strength QTL 41 9.38 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 1 171629477 216629477 Rat 1302787 Stl25 Serum triglyceride level QTL 25 2.7 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 180359209 210702199 Rat 70160 Bw18 Body weight QTL 18 5.7 body mass (VT:0001259) body weight (CMO:0000012) 1 144267353 196383668 Rat 1549830 Bss1 Bone structure and strength QTL 1 4.8 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 172609619 217609619 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 70163 Bw20 Body weight QTL 20 5.1 body mass (VT:0001259) body weight (CMO:0000012) 1 174133260 219133260 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1558658 Bw59 Body weight QTL 59 3.5 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 1 178784622 223784622 Rat 631838 Niddm36 Non-insulin dependent diabetes mellitus QTL 36 0.01 insulin secretion trait (VT:0003564) calculated pancreatic islet insulin release measurement (CMO:0001217) 1 184550676 229550676 Rat 1354636 Lmblg1 Limb length QTL 1 6.4 tibia length (VT:0004357) tibia length (CMO:0000450) 1 151162512 201278233 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 2293689 Bss47 Bone structure and strength QTL 47 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 1 171629477 216629477 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 61341 Bp26 Blood pressure QTL 26 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 169537671 214537671 Rat 1354634 Kidm12 Kidney mass QTL 12 3.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 1 151162512 201278233 Rat 4889428 Stresp24 Stress response QTL 24 0.05 heart pumping trait (VT:2000009) absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162) 1 155866514 200866514 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 61343 Bp28 Blood pressure QTL 28 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 151646613 196646613 Rat 2293693 Bss22 Bone structure and strength QTL 22 33.52 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 1 171629477 216629477 Rat 2300161 Bmd43 Bone mineral density QTL 43 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 1300145 Rf7 Renal function QTL 7 2.96 urine creatinine amount (VT:0010540) urine creatinine level (CMO:0000125) 1 185145134 221264292 Rat 61347 Bp197 Blood pressure QTL 197 4.2 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 1 158633083 203633083 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 61348 Bp30 Blood pressure QTL 30 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144017057 197814409 Rat 2303622 Vencon6 Ventilatory control QTL 6 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 1 154561505 199561505 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631214 Bw61 Body weight QTL61 3.4 0.0001 intramuscular adipose amount (VT:0010044) intramuscular fat area (CMO:0001162) 1 173108781 218108781 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 2300174 Bmd42 Bone mineral density QTL 42 8.4 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 1 171629477 216629477 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 737977 Bp160 Blood pressure QTL 160 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 181133855 226133855 Rat 2293654 Bss30 Bone structure and strength QTL 30 32.65 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 1 171629477 216629477 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 2300187 Bmd41 Bone mineral density QTL 41 8.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 8552891 Epfw5 Epididymal fat weight QTL 5 4.4 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 1 193113876 238113876 Rat 1359018 Hrtrt20 Heart rate QTL 20 3.08 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 185356336 202902618 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 634312 Bp143 Blood pressure QTL 143 3 0.0002 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 182623426 219932796 Rat 1358294 Bw37 Body weight QTL 37 5 0.000011 body mass (VT:0001259) body weight (CMO:0000012) 1 171310381 216310381 Rat 61378 Bp43 Blood pressure QTL 43 22.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 181746937 196383668 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 724559 Pancm1 Pancreatic morphology QTL 1 7.1 islet of Langerhans morphology trait (VT:0005215) pancreatic islet damage composite score (CMO:0001156) 1 181759564 214537555 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 10059600 Bp378 Blood pressure QTL 378 3.08 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 176869060 221869060 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 619613 Bp77 Blood pressure QTL 77 0.01 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 164747424 209747424 Rat 631260 Tcas2 Tongue tumor susceptibility QTL 2 4.93 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 192485903 199050587 Rat 619614 Bp78 Blood pressure QTL 78 0.001 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 169112897 197261052 Rat 2312564 Glom18 Glomerulus QTL 18 2.4 0.003 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 185356336 231689108 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 724562 Rends1 Renal damage susceptibility QTL 1 0.05 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 1 169537671 214537671 Rat 2292222 Bp307 Blood pressure QTL 307 3.06 0.0014 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 213533942 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 10059590 Kidm44 Kidney mass QTL 44 3.42 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 191033875 236033875 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 1600380 Niddm70 Non-insulin dependent diabetes mellitus QTL 70 3.1 0.0008 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 176550523 221550523 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1582206 Kidm33 Kidney mass QTL 33 6.9 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 188377360 224054420 Rat 1354620 Kidm19 Kidney mass QTL 19 4 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 201278233 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 634338 Hcar4 Hepatocarcinoma resistance QTL 4 4.6 liver integrity trait (VT:0010547) liver tumorous lesion number to liver area ratio (CMO:0001210) 1 193422268 214537671 Rat 1354618 Kidm15 Kidney mass QTL 15 5 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 1 156677124 201278233 Rat 6903303 Scl34 Serum cholesterol QTL 34 2.5 0.0033 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 180359209 218108781 Rat 6480780 Insul18 Insulin level QTL 18 4.11 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 189607473 200611765 Rat 152025212 Bw190 Body weight QTL 190 5.7 body mass (VT:0001259) 1 123556856 196963478 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 2293083 Iddm25 Insulin dependent diabetes mellitus QTL 25 4.18 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 181829673 224569684 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 1354602 Bw35 Body weight QTL 35 12.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 201278233 Rat 631670 Iddm10 Insulin dependent diabetes mellitus QTL 10 1.9 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 174133260 196383668 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
6
4
11
113
53
51
22
19
22
6
92
50
93
10
55
29
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000054887 ⟹ ENSRNOP00000051771
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 194,381,975 - 194,383,515 (-) Ensembl Rnor_6.0 Ensembl 1 211,922,389 - 211,923,929 (-) Ensembl
RefSeq Acc Id:
NM_001107558 ⟹ NP_001101028
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 203,811,582 - 203,813,122 (-) NCBI mRatBN7.2 1 194,381,975 - 194,383,515 (-) NCBI Rnor_6.0 1 211,922,389 - 211,923,929 (-) NCBI Rnor_5.0 1 218,843,804 - 218,847,968 (-) NCBI RGSC_v3.4 1 199,397,361 - 199,398,901 (-) RGD Celera 1 192,060,331 - 192,061,871 (-) RGD
Sequence:
CACCGCAGCCGCCCCTAATATCCCTGCCTTCTTTCTCTCTGACCGCCGCCCATTCAGCGCAGCAGCCGTCGGTCCTCTCGCTTTCCCGTGAGGGCCGTCGGCGTCCGCTTGAAACGCGTTACACGCAT
hide sequence
RefSeq Acc Id:
NP_001101028 ⟸ NM_001107558
- UniProtKB:
D3ZZX2 (UniProtKB/TrEMBL), A6HXC1 (UniProtKB/TrEMBL)
- Sequence:
MDANRPGAFVLSSAPLAALHNMAEMKTSLFPYALQGPAGFKTPALGSLGAQLPLGTPHGISDILGRPVGAAGGGLLGSLPRLNGLASSAGVYFGPAAAVARGYPKPLAELPGRPPIFWPGVVQGSPWR
hide sequence
Ensembl Acc Id:
ENSRNOP00000051771 ⟸ ENSRNOT00000054887
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-09-26
Nkx6-2
NK6 homeobox 2
Nkx6-2
NK6 transcription factor related, locus 2 (Drosophila)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Nkx6-2
NK6 transcription factor related, locus 2 (Drosophila)
Nkx6-2_predicted
NK6 transcription factor related, locus 2 (Drosophila) (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Nkx6-2_predicted
NK6 transcription factor related, locus 2 (Drosophila) (predicted)
Symbol and Name status set to approved
70820 APPROVED
