Symbol:
Naaa
Name:
N-acylethanolamine acid amidase
RGD ID:
1307267
Description:
Enables N-(long-chain-acyl)ethanolamine deacylase activity. Involved in N-acylethanolamine metabolic process. Predicted to be located in lysosome and membrane. Orthologous to human NAAA (N-acylethanolamine acid amidase); INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
acylsphingosine deacylase NAAA; ASAH-like protein; Asahl; Asahl_predicted; LOC305237; MGC124515; N-acylethanolamine-hydrolyzing acid amidase; N-acylsphingosine amidohydrolase (acid ceramidase)-like; N-acylsphingosine amidohydrolase (acid ceramidase)-like (predicted); N-acylsphingosine amidohydrolase-like
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 16,061,599 - 16,080,703 (+) NCBI GRCr8 mRatBN7.2 14 15,777,306 - 15,796,411 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 15,777,306 - 15,796,410 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 15,786,134 - 15,805,104 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 17,104,987 - 17,123,957 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 15,800,429 - 15,819,399 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 17,283,262 - 17,302,364 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 17,283,124 - 17,302,366 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 17,199,739 - 17,218,991 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 17,338,759 - 17,358,274 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 17,338,760 - 17,356,973 (+) NCBI Celera 14 15,171,712 - 15,190,788 (+) NCBI Celera Cytogenetic Map 14 p22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Naaa Rat 1,2-dimethylhydrazine increases expression ISO Naaa (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of NAAA mRNA CTD PMID:22206623 Naaa Rat 1,2-dimethylhydrazine multiple interactions ISO Naaa (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of NAAA mRNA] CTD PMID:22206623 Naaa Rat 17beta-estradiol multiple interactions ISO NAAA (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of NAAA mRNA CTD PMID:20660070 Naaa Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of NAAA mRNA CTD PMID:32741896 Naaa Rat 17beta-estradiol increases expression ISO Naaa (Mus musculus) 6480464 Estradiol results in increased expression of NAAA mRNA CTD PMID:19484750 Naaa Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of NAAA mRNA CTD PMID:32741896 Naaa Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of NAAA mRNA CTD PMID:22298810 Naaa Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of NAAA mRNA CTD PMID:34747641 Naaa Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of NAAA mRNA CTD PMID:32109520 Naaa Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Naaa (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Naaa Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Naaa Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Naaa (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of NAAA mRNA CTD PMID:26251327 Naaa Rat 4,4'-sulfonyldiphenol decreases expression ISO Naaa (Mus musculus) 6480464 bisphenol S results in decreased expression of NAAA mRNA CTD PMID:30951980 and PMID:39298647 Naaa Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of NAAA mRNA CTD PMID:36041667 Naaa Rat 4-hydroxyphenyl retinamide decreases expression ISO Naaa (Mus musculus) 6480464 Fenretinide results in decreased expression of NAAA mRNA CTD PMID:28973697 Naaa Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of NAAA mRNA CTD PMID:24780913 Naaa Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of NAAA mRNA CTD PMID:28959563 Naaa Rat all-trans-retinoic acid decreases expression ISO NAAA (Homo sapiens) 6480464 Tretinoin results in decreased expression of NAAA mRNA CTD PMID:33167477 Naaa Rat all-trans-retinoic acid increases expression ISO Naaa (Mus musculus) 6480464 Tretinoin results in increased expression of NAAA mRNA CTD PMID:36189433 Naaa Rat all-trans-retinoic acid multiple interactions ISO Naaa (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of NAAA mRNA CTD PMID:36189433 Naaa Rat antirheumatic drug decreases expression ISO NAAA (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of NAAA mRNA CTD PMID:24449571 Naaa Rat arsane multiple interactions ISO NAAA (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of NAAA mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of NAAA mRNA CTD PMID:39836092 Naaa Rat arsenic atom multiple interactions ISO NAAA (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of NAAA mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of NAAA mRNA CTD PMID:39836092 Naaa Rat arsenous acid increases expression ISO NAAA (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of NAAA mRNA CTD PMID:22521957 Naaa Rat benzene decreases expression ISO NAAA (Homo sapiens) 6480464 Benzene results in decreased expression of NAAA mRNA CTD PMID:20036648 Naaa Rat benzo[a]pyrene decreases expression ISO Naaa (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of NAAA mRNA CTD PMID:21569818 Naaa Rat beta-lapachone increases expression ISO NAAA (Homo sapiens) 6480464 beta-lapachone results in increased expression of NAAA mRNA CTD PMID:38218311 Naaa Rat bis(2-ethylhexyl) phthalate decreases expression ISO NAAA (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of NAAA mRNA CTD PMID:31163220 Naaa Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of NAAA mRNA CTD PMID:33296240 Naaa Rat bisphenol A increases expression ISO Naaa (Mus musculus) 6480464 bisphenol A results in increased expression of NAAA mRNA CTD PMID:32156529 Naaa Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of NAAA mRNA CTD PMID:36041667 Naaa Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NAAA mRNA CTD PMID:34947998 Naaa Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of NAAA mRNA CTD PMID:36041667 Naaa Rat carbon nanotube affects expression ISO Naaa (Mus musculus) 6480464 Nanotubes and Carbon analog affects the expression of NAAA mRNA CTD PMID:25554681 Naaa Rat carbon nanotube decreases expression ISO Naaa (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of NAAA mRNA CTD PMID:25554681 Naaa Rat cisplatin increases expression ISO NAAA (Homo sapiens) 6480464 Cisplatin results in increased expression of NAAA mRNA CTD PMID:27594783 Naaa Rat copper(II) sulfate decreases expression ISO NAAA (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of NAAA mRNA CTD PMID:19549813 Naaa Rat cyclosporin A decreases expression ISO NAAA (Homo sapiens) 6480464 Cyclosporine results in decreased expression of NAAA mRNA CTD PMID:20106945 and PMID:25562108 Naaa Rat diarsenic trioxide increases expression ISO NAAA (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of NAAA mRNA CTD PMID:22521957 Naaa Rat dibutyl phthalate decreases expression ISO Naaa (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of NAAA mRNA CTD PMID:21266533 Naaa Rat dorsomorphin multiple interactions ISO NAAA (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NAAA mRNA CTD PMID:27188386 Naaa Rat epoxiconazole decreases expression ISO Naaa (Mus musculus) 6480464 epoxiconazole results in decreased expression of NAAA mRNA CTD PMID:35436446 Naaa Rat ethanol increases expression ISO Naaa (Mus musculus) 6480464 Ethanol results in increased expression of NAAA mRNA CTD PMID:30319688 Naaa Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of NAAA mRNA CTD PMID:30307764 Naaa Rat folic acid multiple interactions ISO Naaa (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of NAAA mRNA] CTD PMID:22206623 Naaa Rat folic acid decreases expression ISO Naaa (Mus musculus) 6480464 Folic Acid results in decreased expression of NAAA mRNA CTD PMID:25629700 Naaa Rat furan increases methylation EXP 6480464 furan results in increased methylation of NAAA gene CTD PMID:22079235 Naaa Rat furan decreases methylation EXP 6480464 furan results in decreased methylation of NAAA gene CTD PMID:27387713 Naaa Rat furan increases expression EXP 6480464 furan results in increased expression of NAAA mRNA CTD PMID:27387713 Naaa Rat genistein increases expression ISO NAAA (Homo sapiens) 6480464 Genistein results in increased expression of NAAA mRNA CTD PMID:20884965 Naaa Rat lead diacetate increases expression ISO Naaa (Mus musculus) 6480464 lead acetate results in increased expression of NAAA mRNA CTD PMID:22609695 Naaa Rat manganese atom multiple interactions ISO NAAA (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of NAAA mRNA CTD PMID:39836092 Naaa Rat manganese(0) multiple interactions ISO NAAA (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of NAAA mRNA CTD PMID:39836092 Naaa Rat manganese(II) chloride multiple interactions ISO NAAA (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of NAAA mRNA CTD PMID:39836092 Naaa Rat methylseleninic acid decreases expression ISO NAAA (Homo sapiens) 6480464 methylselenic acid results in decreased expression of NAAA mRNA CTD PMID:18548127 Naaa Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Naaa (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of NAAA mRNA CTD PMID:36189433 Naaa Rat nickel sulfate decreases expression ISO NAAA (Homo sapiens) 6480464 nickel sulfate results in decreased expression of NAAA mRNA CTD PMID:16780908 Naaa Rat potassium chromate decreases expression ISO NAAA (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of NAAA mRNA CTD PMID:22714537 Naaa Rat progesterone increases expression ISO NAAA (Homo sapiens) 6480464 Progesterone results in increased expression of NAAA mRNA CTD PMID:17404688 Naaa Rat progesterone multiple interactions ISO NAAA (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of NAAA mRNA CTD PMID:20660070 Naaa Rat SB 431542 multiple interactions ISO NAAA (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NAAA mRNA CTD PMID:27188386 Naaa Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of NAAA mRNA CTD PMID:22431001 Naaa Rat sodium arsenite decreases expression ISO NAAA (Homo sapiens) 6480464 sodium arsenite results in decreased expression of NAAA mRNA CTD PMID:38568856 Naaa Rat sodium arsenite multiple interactions ISO NAAA (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of NAAA mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of NAAA mRNA CTD PMID:39836092 Naaa Rat Soman increases expression EXP 6480464 Soman results in increased expression of NAAA mRNA CTD PMID:19281266 Naaa Rat sunitinib increases expression ISO NAAA (Homo sapiens) 6480464 Sunitinib results in increased expression of NAAA mRNA CTD PMID:31533062 Naaa Rat tacrolimus hydrate increases expression ISO Naaa (Mus musculus) 6480464 Tacrolimus results in increased expression of NAAA mRNA CTD PMID:29362864 Naaa Rat temozolomide decreases expression ISO NAAA (Homo sapiens) 6480464 Temozolomide results in decreased expression of NAAA mRNA CTD PMID:31758290 Naaa Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of NAAA mRNA CTD PMID:32741896 Naaa Rat thimerosal increases expression ISO NAAA (Homo sapiens) 6480464 Thimerosal results in increased expression of NAAA mRNA CTD PMID:27188386 Naaa Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of NAAA mRNA CTD PMID:34492290 Naaa Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of NAAA mRNA CTD PMID:33387578 Naaa Rat trichostatin A increases expression ISO NAAA (Homo sapiens) 6480464 trichostatin A results in increased expression of NAAA mRNA CTD PMID:24935251 Naaa Rat triclosan decreases expression ISO NAAA (Homo sapiens) 6480464 Triclosan results in decreased expression of NAAA mRNA CTD PMID:30510588 Naaa Rat triptonide increases expression ISO Naaa (Mus musculus) 6480464 triptonide results in increased expression of NAAA mRNA CTD PMID:33045310 Naaa Rat valproic acid increases expression ISO NAAA (Homo sapiens) 6480464 Valproic Acid results in increased expression of NAAA mRNA CTD PMID:24383497 and PMID:26272509 Naaa Rat valproic acid multiple interactions ISO NAAA (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NAAA mRNA CTD PMID:27188386 Naaa Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of NAAA mRNA CTD PMID:19015723 Naaa Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of NAAA mRNA CTD PMID:23034163 Naaa Rat zinc atom increases expression ISO NAAA (Homo sapiens) 6480464 Zinc deficiency results in increased expression of NAAA mRNA CTD PMID:18356318 Naaa Rat zinc(0) increases expression ISO NAAA (Homo sapiens) 6480464 Zinc deficiency results in increased expression of NAAA mRNA CTD PMID:18356318
1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (EXP) all-trans-retinoic acid (ISO) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) benzene (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) carbon nanotube (ISO) cisplatin (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) diarsenic trioxide (ISO) dibutyl phthalate (ISO) dorsomorphin (ISO) epoxiconazole (ISO) ethanol (ISO) fenvalerate (EXP) folic acid (ISO) furan (EXP) genistein (ISO) lead diacetate (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methylseleninic acid (ISO) mono(2-ethylhexyl) phthalate (ISO) nickel sulfate (ISO) potassium chromate (ISO) progesterone (ISO) SB 431542 (ISO) silicon dioxide (EXP) sodium arsenite (ISO) Soman (EXP) sunitinib (ISO) tacrolimus hydrate (ISO) temozolomide (ISO) testosterone (EXP) thimerosal (ISO) thioacetamide (EXP) trichloroethene (EXP) trichostatin A (ISO) triclosan (ISO) triptonide (ISO) valproic acid (ISO) vinclozolin (EXP) zinc atom (ISO) zinc(0) (ISO)
Molecular Function
DNA-binding transcription factor binding (IEA,ISO) fatty acid amide hydrolase activity (IEA,ISO,ISS) hydrolase activity (IEA) hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds (IBA,IEA,ISO) N-(long-chain-acyl)ethanolamine deacylase activity (IDA,IEA,ISO,ISS) N-acylsphingosine amidohydrolase activity (IEA,ISO,ISS)
Naaa Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 16,061,599 - 16,080,703 (+) NCBI GRCr8 mRatBN7.2 14 15,777,306 - 15,796,411 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 15,777,306 - 15,796,410 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 15,786,134 - 15,805,104 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 17,104,987 - 17,123,957 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 15,800,429 - 15,819,399 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 17,283,262 - 17,302,364 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 17,283,124 - 17,302,366 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 17,199,739 - 17,218,991 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 17,338,759 - 17,358,274 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 17,338,760 - 17,356,973 (+) NCBI Celera 14 15,171,712 - 15,190,788 (+) NCBI Celera Cytogenetic Map 14 p22 NCBI
NAAA Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 75,910,655 - 75,941,013 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 75,910,655 - 75,941,013 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 76,831,808 - 76,862,166 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 77,050,832 - 77,081,190 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 77,195,814 - 77,219,325 NCBI Celera 4 74,132,297 - 74,162,693 (-) NCBI Celera Cytogenetic Map 4 q21.1 NCBI HuRef 4 72,584,423 - 72,614,591 (-) NCBI HuRef CHM1_1 4 76,808,474 - 76,838,830 (-) NCBI CHM1_1 T2T-CHM13v2.0 4 79,251,154 - 79,281,501 (-) NCBI T2T-CHM13v2.0
Naaa Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 92,405,519 - 92,426,040 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 92,405,518 - 92,426,029 (-) Ensembl GRCm39 Ensembl GRCm38 5 92,257,660 - 92,278,181 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 92,257,659 - 92,278,170 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 92,686,686 - 92,707,207 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 93,333,459 - 93,353,381 (-) NCBI MGSCv36 mm8 Celera 5 90,401,548 - 90,422,177 (-) NCBI Celera Cytogenetic Map 5 E2 NCBI cM Map 5 46.35 NCBI
Naaa Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955433 630,483 - 674,675 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955433 630,627 - 674,675 (-) NCBI ChiLan1.0 ChiLan1.0
NAAA Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 54,131,808 - 54,162,106 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 54,321,585 - 54,351,911 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 48,264,567 - 48,294,872 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 54,102,384 - 54,133,725 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 54,102,384 - 54,128,776 (+) Ensembl panpan1.1 panPan2
NAAA Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 32 483,317 - 504,304 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 32 41,379,385 - 41,398,991 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 32 507,696 - 527,349 (-) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 32 507,868 - 527,523 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 32 460,034 - 485,704 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 32 39,688,753 - 39,708,408 (+) NCBI UU_Cfam_GSD_1.0
Naaa
NAAA Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 71,573,788 - 71,603,338 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 71,573,783 - 71,603,256 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 75,709,382 - 75,738,808 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NAAA Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 24,420,378 - 24,450,010 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 24,423,052 - 24,449,793 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 2,765,526 - 2,792,410 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Naaa
.
Predicted Target Of
Count of predictions: 192 Count of miRNA genes: 144 Interacting mature miRNAs: 155 Transcripts: ENSRNOT00000003102 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
1300114 Srn2 Serum renin concentration QTL 2 3.27 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 14 3813074 21217635 Rat 2293089 Iddm31 Insulin dependent diabetes mellitus QTL 31 4.7 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 14 3813074 18274691 Rat 1581500 Renag1 Renal agenesis QTL 1 kidney development trait (VT:0000527) percentage of study population developing unilateral renal agenesis during a period of time (CMO:0000940) 14 8170668 68298175 Rat 731183 Pia20 Pristane induced arthritis QTL 20 3.55 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 14 9088978 39057237 Rat 631212 Bw5 Body weight QTL5 5.43 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 14 11030812 30320092 Rat 2302277 Gluco38 Glucose level QTL 38 5.8 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 11030622 28035204 Rat 1331740 Bw26 Body weight QTL 26 3.028 body mass (VT:0001259) body weight (CMO:0000012) 14 3813074 30767156 Rat 619619 Rf4 Renal disease susceptibility QTL 4 4.1 0.002 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 14 1 32754612 Rat 1358296 Ael3 Aortic elastin QTL 3 3.7 0.00051 aorta elastin amount (VT:0003905) aortic elastin 14 8267090 53267090 Rat 70195 Mcs8 Mammary carcinoma susceptibility QTL 8 4.28 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 14 3813074 24531477 Rat 2300183 Bmd60 Bone mineral density QTL 60 5.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 14 1 26541967 Rat 631839 Niddm37 Non-insulin dependent diabetes mellitus QTL 37 3.37 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 11030622 95876975 Rat 634352 Apr6 Acute phase response QTL 6 3.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 14 1 41131407 Rat 2300159 Bmd61 Bone mineral density QTL 61 5.3 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 14 1 26541967 Rat 70204 Niddm20 Non-insulin dependent diabetes mellitus QTL 20 5.1 0.000008 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 14 1217606 16960180 Rat 2302045 Pia39 Pristane induced arthritis QTL 39 4.9 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G2a level (CMO:0002116) 14 8267090 53267090 Rat 1300140 Srn3 Serum renin concentration QTL 3 3.19 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 14 14875168 30883947 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000003102 ⟹ ENSRNOP00000003102
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 15,777,306 - 15,796,410 (+) Ensembl Rnor_6.0 Ensembl 14 17,283,124 - 17,302,366 (+) Ensembl
RefSeq Acc Id:
NM_001010967 ⟹ NP_001010967
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 16,061,599 - 16,080,703 (+) NCBI mRatBN7.2 14 15,777,306 - 15,796,411 (+) NCBI Rnor_6.0 14 17,283,262 - 17,302,364 (+) NCBI Rnor_5.0 14 17,199,739 - 17,218,991 (+) NCBI RGSC_v3.4 14 17,338,759 - 17,358,274 (+) RGD Celera 14 15,171,712 - 15,190,788 (+) RGD
Sequence:
CCTCAGCAGCCCGAGCCATGGGGACCCCAGCCATCCGGGCCGCGTGCCATGGGGCACACCTGGCGCTGGCTCTGTTGCTGCTGCTGTCGCTGTCGGATCCCTGGCTGTGGGCGACCGCCCCTGGCACT
hide sequence
RefSeq Acc Id:
NP_001010967 ⟸ NM_001010967
- Peptide Label:
precursor
- UniProtKB:
Q5KTC7 (UniProtKB/Swiss-Prot), Q3KRD3 (UniProtKB/Swiss-Prot), A6KK97 (UniProtKB/TrEMBL)
- Sequence:
MGTPAIRAACHGAHLALALLLLLSLSDPWLWATAPGTPPLFNVSLDAAPELRWLPMLQHYDPDFVRAAVAQVIGDRVPQWILEMIGEIVQKVESFLPQPFTSEIRGICDYLNLSLAEGVLVNLAYEAS
hide sequence
Ensembl Acc Id:
ENSRNOP00000003102 ⟸ ENSRNOT00000003102
RGD ID: 13699215 Promoter ID: EPDNEW_R9740 Type: multiple initiation site Name: Naaa_1 Description: N-acylethanolamine acid amidase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 14 17,283,266 - 17,283,326 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-06-27
Naaa
N-acylethanolamine acid amidase
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-05-15
Naaa
N-acylethanolamine acid amidase
Asahl
N-acylsphingosine amidohydrolase (acid ceramidase)-like
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Asahl
N-acylsphingosine amidohydrolase (acid ceramidase)-like
Asahl_predicted
N-acylsphingosine amidohydrolase (acid ceramidase)-like (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Asahl_predicted
N-acylsphingosine amidohydrolase (acid ceramidase)-like (predicted)
Symbol and Name status set to approved
70820 APPROVED
