Advanced Search (OLGA)

Gene: Sav1 (salvador family WW domain containing protein 1) Rattus norvegicus

Analyze

Symbol:

Sav1

Name:

salvador family WW domain containing protein 1

RGD ID:

1307253

Description:

Predicted to enable identical protein binding activity; protein serine/threonine kinase activator activity; and transcription regulator activator activity. Predicted to be involved in hippo signaling; negative regulation of cell population proliferation; and positive regulation of apoptotic process. Predicted to act upstream of or within several processes, including epithelial cell differentiation; negative regulation of cell population proliferation; and regulation of hippo signaling. Predicted to be located in cytoplasm and nucleus. Predicted to be active in cytosol. Orthologous to human SAV1 (salvador family WW domain containing protein 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; thioacetamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

45 kDa WW domain protein; LOC299116; rWW45; salvador homolog 1; salvador homolog 1 (Drosophila)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SAV1 (salvador family WW domain containing protein 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Sav1 (salvador family WW domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Sav1 (salvador family WW domain containing protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SAV1 (salvador family WW domain containing protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SAV1 (salvador family WW domain containing protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Sav1 (salvador family WW domain containing protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SAV1 (salvador family WW domain containing protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SAV1 (salvador family WW domain containing protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Sav1 (salvador family WW domain containing protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Sav1 (salvador family WW domain containing protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	SAV1 (salvador family WW domain containing protein 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	SAV1 (salvador family WW domain containing protein 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Sav1 (salvador family WW domain containing 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Sav1 (salvador family WW domain containing 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	sav1 (salvador family WW domain containing protein 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	sav1 (salvador family WW domain containing protein 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	sav-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	sav-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	sav	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	sav	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	sav1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	sav1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	94,214,514 - 94,236,354 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	94,214,517 - 94,235,945 (-)	Ensembl				GRCr8
mRatBN7.2	6	88,478,536 - 88,500,121 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	88,478,539 - 88,499,968 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	88,878,630 - 88,899,810 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	89,178,093 - 89,199,271 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	88,617,609 - 88,638,787 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	92,376,470 - 92,398,678 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	92,376,093 - 92,398,525 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	101,825,584 - 101,846,408 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	92,081,608 - 92,101,975 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	86,974,336 - 86,994,740 (-)	NCBI		Celera
RGSC_v3.1	6	92,084,683 - 92,105,492 (-)	NCBI
Cytogenetic Map	6	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

colonic disease (ISS)

hepatocellular carcinoma (ISS)

hereditary breast ovarian cancer syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

4-hydroxyphenyl retinamide (ISO)

aflatoxin B1 (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

Butylbenzyl phthalate (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

epoxiconazole (ISO)

Evodiamine (ISO)

folic acid (ISO)

FR900359 (ISO)

methylmercury chloride (ISO)

nickel atom (ISO)

nickel dichloride (ISO)

nitrates (ISO)

paracetamol (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

piroxicam (ISO)

rac-lactic acid (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

tamoxifen (ISO)

tetrachloroethene (ISO)

thimerosal (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

torcetrapib (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP,ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic process (IEA)

hair follicle development (ISO)

hippo signaling (IBA,IEA,ISO,ISS)

intestinal epithelial cell differentiation (ISO)

keratinocyte differentiation (ISO)

lung epithelial cell differentiation (ISO)

negative regulation of cardiac muscle cell proliferation (ISO)

negative regulation of cell population proliferation (IBA)

negative regulation of epithelial cell proliferation (ISO)

positive regulation of apoptotic process (IBA,ISO)

positive regulation of fat cell differentiation (ISO)

protein stabilization (ISO)

regulation of cell population proliferation (IEA)

regulation of gene expression (IEA)

regulation of organ growth (ISO)

regulation of stem cell population maintenance (ISO)

signal transduction (IEA)

ventricular septum morphogenesis (ISO)

Cellular Component

cytoplasm (IEA,ISO,ISS)

cytosol (IBA,IEA,ISO)

nucleus (IEA,ISO,ISS)

Molecular Function

identical protein binding (IEA,ISO)

molecular adaptor activity (IEA)

protein binding (ISO)

protein serine/threonine kinase activator activity (IEA,ISO)

transcription regulator activator activity (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:16930133	PMID:17517604	PMID:18369314	PMID:19212654	PMID:20080689	PMID:21512031	PMID:22292086

Genomics

Comparative Map Data

Sav1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	94,214,514 - 94,236,354 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	94,214,517 - 94,235,945 (-)	Ensembl				GRCr8
mRatBN7.2	6	88,478,536 - 88,500,121 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	88,478,539 - 88,499,968 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	88,878,630 - 88,899,810 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	89,178,093 - 89,199,271 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	88,617,609 - 88,638,787 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	92,376,470 - 92,398,678 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	92,376,093 - 92,398,525 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	101,825,584 - 101,846,408 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	92,081,608 - 92,101,975 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	86,974,336 - 86,994,740 (-)	NCBI		Celera
RGSC_v3.1	6	92,084,683 - 92,105,492 (-)	NCBI
Cytogenetic Map	6	q24	NCBI

SAV1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	50,633,580 - 50,668,306 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	50,632,058 - 50,668,337 (-)	Ensembl			hg38	GRCh38
GRCh37	14	51,100,298 - 51,135,024 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	50,170,110 - 50,204,773 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	14	50,170,109 - 50,204,773	NCBI
Celera	14	30,967,387 - 31,002,030 (-)	NCBI		Celera
Cytogenetic Map	14	q22.1	NCBI
HuRef	14	31,225,872 - 31,260,642 (-)	NCBI		HuRef
CHM1_1	14	51,038,840 - 51,073,614 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	14	44,839,725 - 44,874,442 (-)	NCBI		T2T-CHM13v2.0

Sav1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	70,011,786 - 70,033,864 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	70,011,786 - 70,033,776 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	12	69,965,009 - 69,988,141 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	69,965,012 - 69,987,002 (-)	Ensembl			mm10	GRCm38
MGSCv37	12	71,065,999 - 71,087,989 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	12	70,883,617 - 70,905,607 (-)	NCBI		MGSCv36	mm8
Celera	12	71,066,736 - 71,086,376 (-)	NCBI		Celera
Cytogenetic Map	12	C2	NCBI
cM Map	12	28.94	NCBI

Sav1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955409	12,200,721 - 12,220,410 (+)	Ensembl
ChiLan1.0	NW_004955409	12,200,721 - 12,221,520 (+)	NCBI	ChiLan1.0	ChiLan1.0

SAV1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	51,772,688 - 51,807,334 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	50,989,615 - 51,024,137 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	31,223,140 - 31,257,871 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	49,525,687 - 49,560,347 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	49,525,687 - 49,560,347 (-)	Ensembl			panPan2	panpan1.1

SAV1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	27,034,606 - 27,061,926 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	27,022,628 - 27,062,611 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	26,788,420 - 26,815,739 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	27,212,701 - 27,240,724 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	27,213,635 - 27,240,729 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	26,868,220 - 26,896,193 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	26,941,329 - 26,968,924 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	27,285,743 - 27,313,496 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Sav1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	59,213,993 - 59,236,456 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936495	14,954,542 - 14,976,580 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936495	14,955,234 - 14,977,720 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SAV1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	180,406,162 - 180,434,196 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	1	180,404,871 - 180,434,458 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	200,696,535 - 200,724,804 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SAV1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	27,710,256 - 27,747,638 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	27,711,970 - 27,747,647 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666053	16,021,200 - 16,056,413 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Sav1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624731	18,262,110 - 18,282,386 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Sav1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	7	83,658,100 - 83,679,007 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Sav1
77 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	376
Count of miRNA genes:	218
Interacting mature miRNAs:	254
Transcripts:	ENSRNOT00000007314
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2293088	Iddm28	Insulin dependent diabetes mellitus QTL 28	5.21		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	6	68767270	135411972	Rat
1331799	Bp211	Blood pressure QTL 211	3.66407		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	88019181	136741135	Rat
4889933	Bss88	Bone structure and strength QTL 88	3.8		tibia size trait (VT:0100001)	tibia total bone volume (CMO:0001724)	6	53684921	98684921	Rat
61329	Eae9	Experimental allergic encephalomyelitis QTL 9	3.7		body mass (VT:0001259)	change in body weight (CMO:0002045)	6	84490437	129490437	Rat
5684992	Bmd83	Bone mineral density QTL 82	4.8		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	6	53684921	98684921	Rat
1331789	Rf37	Renal function QTL 37	3.224		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	6	86494122	112380234	Rat
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	71278722	116278722	Rat
70176	Mcsm1	Mammary carcinoma susceptibility modifier QTL 1			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	64367996	109367996	Rat
1581563	Uae33	Urinary albumin excretion QTL 33			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	93560258	136550638	Rat
10054138	Gmadr3	Adrenal mass QTL 3	3.68	0.00045	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	6	90871046	135871046	Rat
1558641	Cm47	Cardiac mass QTL 47	2.9	0.001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	6	63457441	94939581	Rat
724524	Uae2	Urinary albumin excretion QTL 2	2.7	0.0005	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	79198463	144254945	Rat
737827	Hcar11	Hepatocarcinoma resistance QTL 11	4.4		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	6	46050607	116278722	Rat
2303624	Vencon5	Ventilatory control QTL 5	4.45		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	6	93778632	138778632	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	20859430	113082285	Rat
2293837	Kiddil1	Kidney dilation QTL 1	3.7		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	86867923	110125012	Rat
2293842	Kiddil3	Kidney dilation QTL 3	4.3		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	86867923	110125012	Rat
4889848	Pur25	Proteinuria QTL 25	14	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	63037319	95934232	Rat
10054123	Srcrt6	Stress Responsive Cort QTL 6	2.5	0.0043	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	90871046	135871046	Rat
724536	Uae7	Urinary albumin excretion QTL 7	3.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	93560258	136550638	Rat
5684963	Bss99	Bone structure and strength QTL 99	3.1		tibia area (VT:1000281)	tibia area measurement (CMO:0001382)	6	53684921	98684921	Rat
1576302	Schws4	Schwannoma susceptibility QTL 4		0.0078	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	78204640	123204640	Rat
1581550	Pur8	Proteinuria QTL 8			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	93560258	136550638	Rat
1300075	Glom7	Glomerulus QTL 7	5.6	0.0000002	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	6	76937178	121937178	Rat
6893332	Cm74	Cardiac mass QTL 74	0.4	0.64	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	63457441	94939581	Rat

Markers in Region

BI290482

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	88,500,617 - 88,500,708 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	92,399,175 - 92,399,265	NCBI	Rnor6.0
Rnor_5.0	6	101,846,905 - 101,846,995	UniSTS	Rnor5.0
RGSC_v3.4	6	92,102,472 - 92,102,562	UniSTS	RGSC3.4
Celera	6	86,995,237 - 86,995,327	UniSTS
RH 3.4 Map	6	628.8	UniSTS
Cytogenetic Map	6	q24	UniSTS

BF389156

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	88,499,552 - 88,499,672 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	92,398,110 - 92,398,229	NCBI	Rnor6.0
Rnor_5.0	6	101,845,840 - 101,845,959	UniSTS	Rnor5.0
RGSC_v3.4	6	92,101,407 - 92,101,526	UniSTS	RGSC3.4
Celera	6	86,994,172 - 86,994,291	UniSTS
RH 3.4 Map	6	629.5	UniSTS
Cytogenetic Map	6	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001097581	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039111990	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039111991	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063261704	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AM261215	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC161803	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000007314 ⟹ ENSRNOP00000007314

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	94,214,517 - 94,235,945 (-)	Ensembl
mRatBN7.2 Ensembl	6	88,478,539 - 88,499,968 (-)	Ensembl
Rnor_6.0 Ensembl	6	92,376,093 - 92,398,525 (-)	Ensembl

RefSeq Acc Id:

NM_001097581 ⟹ NP_001091050

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	94,214,894 - 94,236,098 (-)	NCBI
mRatBN7.2	6	88,478,916 - 88,500,121 (-)	NCBI
Rnor_6.0	6	92,376,470 - 92,398,678 (-)	NCBI
Rnor_5.0	6	101,825,584 - 101,846,408 (-)	NCBI
RGSC_v3.4	6	92,081,608 - 92,101,975 (-)	RGD
Celera	6	86,974,336 - 86,994,740 (-)	RGD

Sequence:

show sequence

GTGAGCGGCGGCGGGCGCGCTTAGCGCCGCCAACATGCGGCGGAGCCTGCGGGCGGGCGCGGGC
GGCGGAGACCCGAGGCGAAGGCGGCGCCGGCCCGGGAGGCGGCGGCGGGCGGCGGGCTCGCGGC
CCTAGCGAGGCTGCTGGGGCAGCGGCGGGCGACGTCCGCGAGGATGCTGTCCCGCAAGAAAACC
AAAAACGAGGTGTCTAAGCCGGCCGAGGTTCAGGGCAAGTACGTGAAGAAGGAGACGTCGCCCC
TGCTGCGGAATCTCATGCCTTCATTCATTCGGCACGGTCCAACAATTCCAAGACGGACTGACCT
CTGTCTTCCAGAGTCAAGCGCTAGTGCTTTCTCAGCTTCTGGAGATGGCGTAGTTTCAAGAAAC
CAGAGTTTCCTGAGAACTCCAGTTCAAAGGACGCCTCATGAAGTAATGAGAAGAGAAAGCAACA
GACTGTCCGCACCGTCTTCTTACCTTGTCAGGAGCCTAGCGGATGTCCCTCGGGAATACGGCTC
ATCACAGTCATTTTTAACAGAAGTTAATTTTGCTGTTGAAAATGGAGACTCTGGTTCCCGATAT
TTTTATTCAGATAACTTTTTTGATGGTCAGAGAAGGAGGCCACTTGGAGATCGTGCACAAGAAG
ACTATAGATATTATGAATACAACCATGATCTCTTCCAAAGAATGCCACAGAATCAGGGGAGGCA
CACATCAGGTATTGGGAGAGTCACTGCTACATCTTTAGGAAATTTAACTAACCATGGATCTGAA
GATTTACCCCTTCCTCCTGGCTGGTCTGTGGACTGGACAATGAGAGGGAGAAAATACTACATAG
ATCATAACACAAACACAACTCATTGGAGTCATCCTCTTGAACGAGAAGGACTTCCTCCTGGGTG
GGAGCGAGTGGAATCATCAGAATTTGGAACCTATTATGTGGATCACACAAATAAAAGGGCTCAG
TACAGGCACCCCTGTGCTCCCAGTGTGCCTCGGTATGATCAGCCTCCACCCATCACGTATCAGC
CACAGCAAACTGAAAGAAATCAGTCTCTCCTGGTCCCTGCAAACCCCTACCATACTGCAGAAAT
TCCTGACTGGCTTCAGGTTTATGCCCGAGCCCCTGTGAAATACGACCACATTCTGAAGTGGGAG
CTCTTCCAGCTGGCTGACCTGGACACGTACCAGGGAATGCTGAAGCTGCTCTTCATGAAGGAGC
TGGAGCAGATTGTCAAGTTGTATGAGGCCTACAGACAGGCTCTTGTCACCGAGCTGGAAAACCG
CAAGCAGAGGCAGCAGTGGTATGCCCAGCACCATGGCAAGAAGTTTTTAAGTTAACTTTCCACA
AGCCAGGTTTTGTAAGAGCTTTAAAATATTTTCAGATAAATGACTGCAAACAAGTTCTTTGGTT
AATAAAGGCAACTTACTATTTGGAATTACAAAATTCTAGTTTTACATATATTATCAACTTTTTC
TTTTATTGAACCAAGAAAGTTTTATCACTTAAAAAGCCAATATGGCATATACTACCAAATGCTG
TTAGGAAACTGCTTTGGAGACTGTGGATGGAAAGGAGTACAGGAAGAGACTGTCATAAATGGCA
TTAAACAGGAGTGGACACACCCTTCTTGTTCCGAAAAGGAAGCGGACGAGAGCACACTGTGAAC
AGCGGCTCCTTGTGGTGTCAGGTGTTTTCTGGAATGAGATGGTGTGACCATTGCCATGGGTATA
GTTCAGAATAAAAACAGGGCATGGAGCCTTTATGGGGACAAACGTGTATATGGTGTGTGTGGTC
ATCTACTCCCACCTCCTCCCTATGTGAGGGACACCTTTGAAGGAGGGAGATAAAGCCTTTCAGG
AATAGAGTCAGGAATACGGGAATATAATAAATACGGGCCTCAGTTGGTGCGAAACTGTTGCTAA
TACTGCTTCCTTCCTTCCTTTGAGCCAGAGCACATGAGTACAGTCAGCAAGGCTCTGGTGAGAC
ACAGCACGGGCTTCCTGACCACAGGGAATACTGTCTTCCATCAGGCTGGGCTACGTGCCAAAA

hide sequence

RefSeq Acc Id:

XM_039111990 ⟹ XP_038967918

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	94,214,514 - 94,235,908 (-)	NCBI
mRatBN7.2	6	88,478,536 - 88,499,931 (-)	NCBI

RefSeq Acc Id:

XM_039111991 ⟹ XP_038967919

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	94,214,514 - 94,236,354 (-)	NCBI
mRatBN7.2	6	88,479,684 - 88,500,000 (-)	NCBI

RefSeq Acc Id:

XM_063261704 ⟹ XP_063117774

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	94,218,610 - 94,236,354 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001091050	(Get FASTA)	NCBI Sequence Viewer
	XP_038967918	(Get FASTA)	NCBI Sequence Viewer
	XP_038967919	(Get FASTA)	NCBI Sequence Viewer
	XP_063117774	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	A4V8B4	(Get FASTA)	NCBI Sequence Viewer
	AAI61803	(Get FASTA)	NCBI Sequence Viewer
	CAJ98868	(Get FASTA)	NCBI Sequence Viewer
	EDM03536	(Get FASTA)	NCBI Sequence Viewer
	EDM03537	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000007314
	ENSRNOP00000007314.4

RefSeq Acc Id:

NP_001091050 ⟸ NM_001097581

- UniProtKB:

A4V8B4 (UniProtKB/Swiss-Prot), B1WBL9 (UniProtKB/TrEMBL), A6HBY2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MLSRKKTKNEVSKPAEVQGKYVKKETSPLLRNLMPSFIRHGPTIPRRTDLCLPESSASAFSASG
DGVVSRNQSFLRTPVQRTPHEVMRRESNRLSAPSSYLVRSLADVPREYGSSQSFLTEVNFAVEN
GDSGSRYFYSDNFFDGQRRRPLGDRAQEDYRYYEYNHDLFQRMPQNQGRHTSGIGRVTATSLGN
LTNHGSEDLPLPPGWSVDWTMRGRKYYIDHNTNTTHWSHPLEREGLPPGWERVESSEFGTYYVD
HTNKRAQYRHPCAPSVPRYDQPPPITYQPQQTERNQSLLVPANPYHTAEIPDWLQVYARAPVKY
DHILKWELFQLADLDTYQGMLKLLFMKELEQIVKLYEAYRQALVTELENRKQRQQWYAQHHGKK
FLS

hide sequence

Ensembl Acc Id:

ENSRNOP00000007314 ⟸ ENSRNOT00000007314

RefSeq Acc Id:	XP_038967918 ⟸ XM_039111990
- Peptide Label:	isoform X1
- UniProtKB:	A6HBY2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038967919 ⟸ XM_039111991
- Peptide Label:	isoform X2
- UniProtKB:	A6HBY2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063117774 ⟸ XM_063261704
- Peptide Label:	isoform X3

Protein Domains

SARAH WW

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A4V8B4-F1-model_v2	AlphaFold	A4V8B4	1-387	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307253	AgrOrtholog
BioCyc Gene	G2FUF-37219	BioCyc
Ensembl Genes	ENSRNOG00000005264	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000007314	ENTREZGENE
	ENSRNOT00000007314.7	UniProtKB/Swiss-Prot
Gene3D-CATH	2.20.70.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:8371277	IMAGE-MGC_LOAD
InterPro	SARAH_dom	UniProtKB/Swiss-Prot
	Sav	UniProtKB/Swiss-Prot
	WW_dom	UniProtKB/Swiss-Prot
	WW_dom_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:299116	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:187211	IMAGE-MGC_LOAD
NCBI Gene	299116	ENTREZGENE
PANTHER	PROTEIN SALVADOR HOMOLOG 1	UniProtKB/Swiss-Prot
	PTHR47522	UniProtKB/Swiss-Prot
Pfam	PF00397	UniProtKB/Swiss-Prot
PhenoGen	Sav1	PhenoGen
PROSITE	SARAH	UniProtKB/Swiss-Prot
	WW_DOMAIN_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000005264	RatGTEx
SMART	SM00456	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF51045	UniProtKB/Swiss-Prot
UniProt	A4V8B4	ENTREZGENE
	A6HBY2	ENTREZGENE, UniProtKB/TrEMBL
	B1WBL9	ENTREZGENE, UniProtKB/TrEMBL
	SAV1_RAT	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2014-04-23	Sav1	salvador family WW domain containing protein 1	Sav1	salvador homolog 1 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Sav1	salvador homolog 1 (Drosophila)	Sav1_predicted	salvador homolog 1 (Drosophila) (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Sav1_predicted	salvador homolog 1 (Drosophila) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - MGI

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - MGI