Advanced Search (OLGA)

Gene: Fhl3 (four and a half LIM domains 3) Rattus norvegicus

Analyze

Symbol:

Fhl3

Name:

four and a half LIM domains 3

RGD ID:

1307180

Description:

Predicted to enable actin binding activity and transcription coregulator activity. Predicted to be involved in actin cytoskeleton organization. Predicted to be located in cytoplasm. Predicted to be active in Z disc; nucleus; and stress fiber. Orthologous to human FHL3 (four and a half LIM domains 3); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acetamide; acrylamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

four and a half LIM domains protein 3; LOC313582

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FHL3 (four and a half LIM domains 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Fhl3 (four and a half LIM domains 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Fhl3 (four and a half LIM domains 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FHL3 (four and a half LIM domains 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FHL3 (four and a half LIM domains 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Fhl3 (four and a half LIM domains 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FHL3 (four and a half LIM domains 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FHL3 (four and a half LIM domains 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Fhl3 (four and a half LIM domains 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Fhl3 (four and a half LIM domains 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	FHL3 (four and a half LIM domains 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	FHL3 (four and a half LIM domains 3)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Fhl3 (four and a half LIM domains 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Fhl3 (four and a half LIM domains 3)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fhl3a (four and a half LIM domains 3a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fhl3a (four and a half LIM domains 3a)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fhl3b (four and a half LIM domains 3b)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fhl3b (four and a half LIM domains 3b)	Alliance	DIOPT (InParanoid\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	lim-9	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	fhl3	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	142,238,634 - 142,246,011 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	142,235,109 - 142,246,034 (+)	Ensembl				GRCr8
mRatBN7.2	5	136,953,947 - 136,961,317 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	136,950,411 - 136,961,317 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	139,657,330 - 139,664,062 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	141,427,341 - 141,434,073 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	141,434,520 - 141,441,252 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	142,688,962 - 142,696,330 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	142,689,026 - 142,696,383 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	146,460,220 - 146,466,971 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	144,026,444 - 144,033,195 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	135,477,416 - 135,484,165 (+)	NCBI		Celera
RGSC_v3.1	5	144,036,342 - 144,043,658 (+)	NCBI
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Colorectal Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4-dinitrobenzenesulfonic acid (ISO)

2-methylcholine (ISO)

4,4'-sulfonyldiphenol (ISO)

5-fluorouracil (ISO)

acetamide (EXP)

acrylamide (EXP)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

azathioprine (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper(II) chloride (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dextran sulfate (ISO)

diazinon (ISO)

dibutyl phthalate (EXP)

dicrotophos (ISO)

endosulfan (EXP)

erianin (ISO)

folic acid (ISO)

fulvestrant (ISO)

gentamycin (EXP)

GW 7647 (EXP)

hydrogen peroxide (ISO)

ivermectin (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

nitrates (ISO)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (EXP)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

pirinixic acid (ISO)

rotenone (EXP)

sodium arsenate (ISO)

sodium arsenite (ISO)

Soman (EXP)

sunitinib (ISO)

temozolomide (ISO)

testosterone (ISO)

tetrachloromethane (EXP)

theophylline (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

triphenyl phosphate (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

actin cytoskeleton organization (IBA,ISO)

DNA-templated transcription (IEA)

Cellular Component

cytoplasm (IEA)

nucleus (IBA,IEA,ISO)

stress fiber (IBA,ISO)

Z disc (IBA,ISO)

Molecular Function

actin binding (IBA,ISO)

metal ion binding (IEA)

protein binding (ISO)

transcription coregulator activity (IBA)

zinc ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12704194	PMID:21423176

Genomics

Comparative Map Data

Fhl3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	142,238,634 - 142,246,011 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	142,235,109 - 142,246,034 (+)	Ensembl				GRCr8
mRatBN7.2	5	136,953,947 - 136,961,317 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	136,950,411 - 136,961,317 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	139,657,330 - 139,664,062 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	141,427,341 - 141,434,073 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	141,434,520 - 141,441,252 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	142,688,962 - 142,696,330 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	142,689,026 - 142,696,383 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	146,460,220 - 146,466,971 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	144,026,444 - 144,033,195 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	135,477,416 - 135,484,165 (+)	NCBI		Celera
RGSC_v3.1	5	144,036,342 - 144,043,658 (+)	NCBI
Cytogenetic Map	5	q36	NCBI

FHL3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	37,996,770 - 38,005,514 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	37,994,394 - 38,006,380 (-)	Ensembl			hg38	GRCh38
GRCh37	1	38,462,442 - 38,471,186 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	38,235,029 - 38,243,821 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	38,131,535 - 38,140,327	NCBI
Celera	1	36,741,060 - 36,749,863 (-)	NCBI		Celera
Cytogenetic Map	1	p34.3	NCBI
HuRef	1	36,580,786 - 36,583,450 (-)	NCBI		HuRef
CHM1_1	1	38,578,203 - 38,586,947 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	37,863,951 - 37,872,693 (-)	NCBI		T2T-CHM13v2.0

Fhl3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	124,589,750 - 124,602,404 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	124,594,494 - 124,602,404 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	4	124,695,964 - 124,708,611 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	124,700,701 - 124,708,611 (+)	Ensembl			mm10	GRCm38
MGSCv37	4	124,377,943 - 124,385,855 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	4	122,022,424 - 122,030,374 (+)	NCBI		MGSCv36	mm8
MGSCv36	4	124,203,005 - 124,210,404 (+)	NCBI		MGSCv36	mm8
Cytogenetic Map	4	D2.2	NCBI
cM Map	4	57.88	NCBI

Fhl3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955452	15,719,455 - 15,721,677 (-)	Ensembl
ChiLan1.0	NW_004955452	15,718,832 - 15,721,697 (-)	NCBI	ChiLan1.0	ChiLan1.0

FHL3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	188,826,167 - 188,841,893 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	187,962,142 - 187,971,052 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	37,270,357 - 37,279,144 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	38,618,231 - 38,626,542 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	38,618,231 - 38,626,543 (-)	Ensembl			panPan2	panpan1.1

FHL3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	4,588,101 - 4,590,994 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	4,582,483 - 4,590,435 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	4,825,627 - 4,833,145 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	4,711,447 - 4,718,966 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	4,710,897 - 4,718,411 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	4,571,965 - 4,579,485 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	4,638,251 - 4,645,770 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	4,654,793 - 4,662,313 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Fhl3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	54,295,520 - 54,303,502 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	20,119,754 - 20,122,800 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	20,119,775 - 20,125,783 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FHL3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	93,980,635 - 93,988,573 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	93,980,637 - 93,988,568 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	86,751,332 - 86,759,242 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FHL3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	94,864,794 - 94,873,500 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	94,870,608 - 94,873,616 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666033	21,952,508 - 21,961,313 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fhl3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624764	20,642,134 - 20,649,696 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624764	20,642,101 - 20,649,732 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Fhl3
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	33,592,379 - 33,600,026 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Fhl3
125 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	103
Count of miRNA genes:	71
Interacting mature miRNAs:	78
Transcripts:	ENSRNOT00000010007
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	102105698	152749382	Rat
2303586	Gluco52	Glucose level QTL 52	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	100826632	145826632	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	130249266	172190305	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	44924861	153890773	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	116702075	161702075	Rat
1354583	Despr3	Despair related QTL3	4.98	0.0002	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	5	132930505	172190305	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	141212838	172190305	Rat
1300122	Wbc1	White blood cell count QTL 1	2.75		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	5	130678987	145274255	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	99905133	172190305	Rat
70156	Niddm30	Non-insulin dependent diabetes mellitus QTL 30	3.98		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	5	134369218	156289444	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	133789363	172190305	Rat
1331803	Rf32	Renal function QTL 32	2.798		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	134369199	172190305	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	65089051	166764498	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	136631198	172190305	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	112142946	157142946	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	112142946	157142946	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	110770739	155770739	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	133081618	172190305	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	51657967	166600247	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	138002522	170842766	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	112142946	157142946	Rat
1581505	Rf54	Renal function QTL 54			kidney physiology trait (VT:0002136)	kidney 20-HETE level (CMO:0001854)	5	133270647	172190305	Rat
2317753	Glom24	Glomerulus QTL 24	3.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	5	141764300	172190305	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	133789363	172190305	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	98972960	143972960	Rat
1581510	Cm54	Cardiac mass QTL 54	3.4	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	125969677	172190305	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55124766	172190305	Rat
2303618	Vencon1	Ventilatory control QTL 1	3.8		respiration trait (VT:0001943)	oxygen consumption (CMO:0002169)	5	100826632	145826632	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	111236572	156236572	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	131708216	172190305	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	114131300	159131300	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	125969677	156302135	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	112142946	157142946	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	116702075	161702075	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	112142946	157142946	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	116702075	161702075	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	74335621	156302135	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	116702075	161702075	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	114131300	159131300	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	133081618	172190305	Rat
7411722	Strs6	Sensitivity to stroke QTL 6	3.9		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	5	140258140	143398122	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	104262817	153890625	Rat

Markers in Region

AI171676

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	136,961,140 - 136,961,272 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	142,696,149 - 142,696,280	NCBI	Rnor6.0
Rnor_5.0	5	146,467,265 - 146,467,396	UniSTS	Rnor5.0
RGSC_v3.4	5	144,033,489 - 144,033,620	UniSTS	RGSC3.4
Celera	5	135,484,459 - 135,484,590	UniSTS
RH 3.4 Map	5	892.2	UniSTS
Cytogenetic Map	5	q36	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	163	91	90	59	92	59	6	355	192	11	142	80	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001107979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008764016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008764017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039110011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC142187	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000010007 ⟹ ENSRNOP00000010007

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	142,238,513 - 142,246,009 (+)	Ensembl
mRatBN7.2 Ensembl	5	136,954,010 - 136,961,309 (+)	Ensembl
Rnor_6.0 Ensembl	5	142,689,026 - 142,696,383 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000109898 ⟹ ENSRNOP00000084471

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	142,238,513 - 142,246,034 (+)	Ensembl
mRatBN7.2 Ensembl	5	136,957,479 - 136,961,317 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000113747 ⟹ ENSRNOP00000082998

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	142,235,109 - 142,246,009 (+)	Ensembl
mRatBN7.2 Ensembl	5	136,950,411 - 136,961,317 (+)	Ensembl

RefSeq Acc Id:

NM_001107979 ⟹ NP_001101449

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	142,238,790 - 142,245,541 (+)	NCBI
mRatBN7.2	5	136,954,095 - 136,960,847 (+)	NCBI
Rnor_6.0	5	142,689,104 - 142,695,855 (+)	NCBI
Rnor_5.0	5	146,460,220 - 146,466,971 (+)	NCBI
RGSC_v3.4	5	144,026,444 - 144,033,195 (+)	RGD
Celera	5	135,477,416 - 135,484,165 (+)	RGD

Sequence:

show sequence

CCGCCCCACCCACGCCGCTCGCGCCCAAGCTCCCGCGCCCGCTTCGAGGGCTCACTGGGCACCG
CCACCATGAGTGAAGCATTTGACTGTGCAAAATGCAATGAGTCCTTGTACGGCCGCAAATACAT
CCAGACAGACAGCGGCCCCTACTGTGTTCCCTGCTACGACAACACCTTCGCCAACACCTGTGCC
GAGTGCCAGCAGCTCATCGGCCACGATTCAAGGGAACTGTTTTATGAGGATCGCCACTTCCACG
AGGGCTGCTTCCGCTGCTGCCGCTGCCAGCGCTCCCTCGCCGATGAGCCCTTCACCTGTCAGGA
CAGTGAGCTTCTCTGTAATGAGTGCTACTGTACAGCCTTCTCTTCCCAGTGCTCTGCCTGTGGG
GAGACCGTCATGCCCGGGTCCCGGAAGCTGGAGTATGGAGGCCAGACGTGGCATGAACACTGCT
TTCTGTGCAGTGGCTGTGAGCAGCCACTAGGCTCCCGCTCCTTCGTGCCTGACAAGGGTGCTCA
CTACTGCGTGCCTTGCTATGAGAACAAATTTGCTCCTCGGTGTGCCCGCTGCAGCAAGACGCTG
ACCCAGGGCGGAGTGACATATCGCGATCAGCCCTGGCATCGAGAGTGCCTGGTCTGCACTGGGT
GCCAGACGCCCCTCGCAGGGCAGCAGTTCACATCCCGGGATGATGATCCCTACTGTGTGGCCTG
CTTTGGAGAACTCTTTGCACCCAAGTGCAGCAGCTGCAAGCGTCCCATCACAGGTGGGAGCGGC
AGCGAGGGCGCAGGACTCGGTGGAGGCAAGTACGTGTCCTTCGAAGACCGACATTGGCACCACA
GCTGCTTTTCCTGTGCCCGCTGCTCCACCTCCCTGGTGGGCCAAGGCTTTGTACCAGATGGAGA
CCAAGTTCTGTGCCAGGGCTGCAGCCAAGCAGGCCCCTGAGCCCAGGCTCCTGACTCTCCTCTT
TCCCAAACCAAGGGTTCAAGACTATGGCTCCTTTTCTGAACCACTTCTGGGGCCCAGCCCCTCC
CTAGAATGGGCCTCCCCAGTTCCCCACTCATGGAGACTTCAAG

hide sequence

RefSeq Acc Id:

XM_039110011 ⟹ XP_038965939

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	142,238,634 - 142,246,011 (+)	NCBI
mRatBN7.2	5	136,953,947 - 136,961,317 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001101449	(Get FASTA)	NCBI Sequence Viewer
	XP_038965939	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL80399	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010007
	ENSRNOP00000010007.6
	ENSRNOP00000082998.1
	ENSRNOP00000084471.2

RefSeq Acc Id:

NP_001101449 ⟸ NM_001107979

- UniProtKB:

D3ZPF0 (UniProtKB/TrEMBL), A0A8I6A1C9 (UniProtKB/TrEMBL), A6IS48 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSEAFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEG
CFRCCRCQRSLADEPFTCQDSELLCNECYCTAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFL
CSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQ
TPLAGQQFTSRDDDPYCVACFGELFAPKCSSCKRPITGGSGSEGAGLGGGKYVSFEDRHWHHSC
FSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP

hide sequence

Ensembl Acc Id:

ENSRNOP00000010007 ⟸ ENSRNOT00000010007

RefSeq Acc Id:	XP_038965939 ⟸ XM_039110011
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6A1C9 (UniProtKB/TrEMBL), A6IS48 (UniProtKB/TrEMBL), D3ZPF0 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000084471 ⟸ ENSRNOT00000109898

Ensembl Acc Id:

ENSRNOP00000082998 ⟸ ENSRNOT00000113747

Protein Domains

LIM zinc-binding

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZPF0-F1-model_v2	AlphaFold	D3ZPF0	1-288	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694011

Promoter ID:

EPDNEW_R4535

Type:

initiation region

Name:

Fhl3_1

Description:

four and a half LIM domains 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	142,689,007 - 142,689,067	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307180	AgrOrtholog
BioCyc Gene	G2FUF-39957	BioCyc
Ensembl Genes	ENSRNOG00000007541	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000010007	ENTREZGENE
	ENSRNOT00000010007.8	UniProtKB/TrEMBL
	ENSRNOT00000109898.2	UniProtKB/TrEMBL
	ENSRNOT00000113747.2	UniProtKB/TrEMBL
Gene3D-CATH	Cysteine Rich Protein	UniProtKB/TrEMBL
InterPro	LIM_FHL1/2/3/5_N	UniProtKB/TrEMBL
	Znf_LIM	UniProtKB/TrEMBL
KEGG Report	rno:313582	UniProtKB/TrEMBL
NCBI Gene	313582	ENTREZGENE
PANTHER	FOUR AND A HALF LIM DOMAINS PROTEIN 3	UniProtKB/TrEMBL
	PTHR24205	UniProtKB/TrEMBL
Pfam	LIM	UniProtKB/TrEMBL
	LIM_FHL2-3_N	UniProtKB/TrEMBL
PhenoGen	Fhl3	PhenoGen
PROSITE	LIM_DOMAIN_1	UniProtKB/TrEMBL
	LIM_DOMAIN_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000007541	RatGTEx
SMART	LIM	UniProtKB/TrEMBL
Superfamily-SCOP	Glucocorticoid receptor-like (DNA-binding domain)	UniProtKB/TrEMBL
UniProt	A0A8I5ZYD8_RAT	UniProtKB/TrEMBL
	A0A8I6A1C9	ENTREZGENE, UniProtKB/TrEMBL
	A6IS48	ENTREZGENE, UniProtKB/TrEMBL
	D3ZPF0	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Fhl3	four and a half LIM domains 3	Fhl3_predicted	four and a half LIM domains 3 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Fhl3_predicted	four and a half LIM domains 3 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD