Symbol:
Tmprss6
Name:
transmembrane serine protease 6
RGD ID:
1307138
Description:
Predicted to enable serine-type endopeptidase activity. Predicted to be involved in intracellular iron ion homeostasis; proteolysis; and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within multicellular organismal-level iron ion homeostasis and negative regulation of BMP signaling pathway. Predicted to be located in extracellular space. Predicted to be active in plasma membrane. Human ortholog(s) of this gene implicated in microcytic anemia. Orthologous to human TMPRSS6 (transmembrane serine protease 6); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC315388; transmembrane protease serine 6; transmembrane protease, serine 6
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 111,871,504 - 111,902,127 (-) NCBI GRCr8 mRatBN7.2 7 109,991,008 - 110,021,626 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 109,985,931 - 110,021,624 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 111,741,252 - 111,771,803 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 113,964,790 - 113,995,347 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 113,932,869 - 113,963,426 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 119,659,323 - 119,689,953 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 119,659,324 - 119,689,938 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 119,649,831 - 119,680,259 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 116,391,730 - 116,419,671 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 116,425,992 - 116,456,922 (-) NCBI Celera 7 106,329,190 - 106,359,893 (-) NCBI Celera Cytogenetic Map 7 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tmprss6 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of TMPRSS6 mRNA] CTD PMID:31150632 Tmprss6 Rat (1->4)-beta-D-glucan multiple interactions ISO Tmprss6 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TMPRSS6 mRNA CTD PMID:36331819 Tmprss6 Rat 17alpha-ethynylestradiol increases expression ISO Tmprss6 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of TMPRSS6 mRNA CTD PMID:17942748 Tmprss6 Rat 17alpha-ethynylestradiol multiple interactions ISO Tmprss6 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of TMPRSS6 mRNA CTD PMID:17942748 Tmprss6 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Tmprss6 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of TMPRSS6 mRNA and Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to TMPRSS6 gene] CTD PMID:17942748 and PMID:28213091 Tmprss6 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TMPRSS6 mRNA CTD PMID:33387578 Tmprss6 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of TMPRSS6 mRNA CTD PMID:32109520 Tmprss6 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Tmprss6 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of TMPRSS6 mRNA CTD PMID:28213091 Tmprss6 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Tmprss6 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TMPRSS6 mRNA CTD PMID:21570461 Tmprss6 Rat 2,3,7,8-Tetrachlorodibenzofuran increases expression EXP 6480464 2 more ... CTD PMID:32109520 Tmprss6 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Tmprss6 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Tmprss6 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of TMPRSS6 mRNA CTD PMID:21346803 Tmprss6 Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO Tmprss6 (Mus musculus) 6480464 3 more ... CTD PMID:19467301 Tmprss6 Rat 4,4'-sulfonyldiphenol decreases expression ISO Tmprss6 (Mus musculus) 6480464 bisphenol S results in decreased expression of TMPRSS6 mRNA CTD PMID:39298647 Tmprss6 Rat 4,4'-sulfonyldiphenol decreases methylation ISO TMPRSS6 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of TMPRSS6 gene CTD PMID:31601247 Tmprss6 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of TMPRSS6 mRNA CTD PMID:30047161 Tmprss6 Rat 7,12-dimethyltetraphene decreases expression EXP 6480464 9 more ... CTD PMID:19480007 Tmprss6 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of TMPRSS6 mRNA CTD PMID:31881176 Tmprss6 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of TMPRSS6 mRNA CTD PMID:28959563 Tmprss6 Rat aflatoxin B1 decreases expression ISO TMPRSS6 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of TMPRSS6 mRNA CTD PMID:22100608 Tmprss6 Rat aflatoxin B1 decreases methylation ISO TMPRSS6 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of TMPRSS6 intron CTD PMID:30157460 Tmprss6 Rat aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of TMPRSS6 mRNA CTD PMID:23630614 Tmprss6 Rat aristolochic acid A increases expression ISO TMPRSS6 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of TMPRSS6 mRNA CTD PMID:33212167 Tmprss6 Rat benzo[a]pyrene decreases expression ISO Tmprss6 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of TMPRSS6 mRNA CTD PMID:19770486 Tmprss6 Rat benzo[a]pyrene affects methylation ISO TMPRSS6 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of TMPRSS6 intron and Benzo(a)pyrene affects the methylation of TMPRSS6 promoter CTD PMID:27901495 and PMID:30157460 Tmprss6 Rat benzo[a]pyrene increases methylation ISO TMPRSS6 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of TMPRSS6 3' UTR CTD PMID:27901495 Tmprss6 Rat benzo[a]pyrene decreases expression ISO TMPRSS6 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of TMPRSS6 mRNA CTD PMID:21871943 more ... Tmprss6 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TMPRSS6 mRNA CTD PMID:25181051 Tmprss6 Rat bisphenol A increases expression ISO Tmprss6 (Mus musculus) 6480464 bisphenol A results in increased expression of TMPRSS6 mRNA CTD PMID:33221593 Tmprss6 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TMPRSS6 mRNA CTD PMID:32145629 Tmprss6 Rat buta-1,3-diene decreases expression ISO Tmprss6 (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of TMPRSS6 mRNA CTD PMID:29038090 Tmprss6 Rat CGP 52608 multiple interactions ISO TMPRSS6 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to TMPRSS6 gene] CTD PMID:28238834 Tmprss6 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of TMPRSS6 mRNA CTD PMID:26577399 Tmprss6 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of TMPRSS6 mRNA CTD PMID:21658437 Tmprss6 Rat elemental selenium increases expression ISO TMPRSS6 (Homo sapiens) 6480464 Selenium results in increased expression of TMPRSS6 mRNA CTD PMID:19244175 Tmprss6 Rat fenthion increases expression ISO Tmprss6 (Mus musculus) 6480464 Fenthion results in increased expression of TMPRSS6 mRNA CTD PMID:34813904 Tmprss6 Rat formaldehyde increases expression ISO TMPRSS6 (Homo sapiens) 6480464 Formaldehyde results in increased expression of TMPRSS6 mRNA CTD PMID:18045764 Tmprss6 Rat furan increases methylation EXP 6480464 furan results in increased methylation of TMPRSS6 gene CTD PMID:22079235 Tmprss6 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of TMPRSS6 mRNA CTD PMID:33387578 Tmprss6 Rat iron atom affects abundance ISO TMPRSS6 (Homo sapiens) 6480464 TMPRSS6 gene SNP affects the abundance of Iron CTD PMID:19820698 and PMID:19820699 Tmprss6 Rat iron(0) affects abundance ISO TMPRSS6 (Homo sapiens) 6480464 TMPRSS6 gene SNP affects the abundance of Iron CTD PMID:19820698 and PMID:19820699 Tmprss6 Rat L-ascorbic acid multiple interactions ISO TMPRSS6 (Homo sapiens) 6480464 [Quercetin co-treated with Ascorbic Acid] results in decreased expression of TMPRSS6 mRNA CTD PMID:17639512 Tmprss6 Rat lipopolysaccharide increases expression ISO TMPRSS6 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of TMPRSS6 mRNA CTD PMID:35811015 Tmprss6 Rat lipopolysaccharide multiple interactions ISO TMPRSS6 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of TMPRSS6 mRNA CTD PMID:35811015 Tmprss6 Rat methapyrilene decreases expression ISO TMPRSS6 (Homo sapiens) 6480464 Methapyrilene results in decreased expression of TMPRSS6 mRNA CTD PMID:30157460 Tmprss6 Rat methidathion increases expression ISO Tmprss6 (Mus musculus) 6480464 methidathion results in increased expression of TMPRSS6 mRNA CTD PMID:34813904 Tmprss6 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in decreased expression of TMPRSS6 mRNA CTD PMID:28943392 Tmprss6 Rat N-Nitrosopyrrolidine decreases expression ISO TMPRSS6 (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in decreased expression of TMPRSS6 mRNA CTD PMID:32234424 Tmprss6 Rat O-methyleugenol decreases expression ISO TMPRSS6 (Homo sapiens) 6480464 methyleugenol results in decreased expression of TMPRSS6 mRNA CTD PMID:32234424 Tmprss6 Rat ozone decreases expression ISO Tmprss6 (Mus musculus) 6480464 Ozone results in decreased expression of TMPRSS6 mRNA CTD PMID:31626304 Tmprss6 Rat paracetamol affects expression ISO Tmprss6 (Mus musculus) 6480464 Acetaminophen affects the expression of TMPRSS6 mRNA CTD PMID:17562736 Tmprss6 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of TMPRSS6 mRNA CTD PMID:33387578 Tmprss6 Rat paracetamol decreases expression ISO TMPRSS6 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of TMPRSS6 mRNA CTD PMID:29067470 Tmprss6 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Tmprss6 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TMPRSS6 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of TMPRSS6 mRNA CTD PMID:36331819 Tmprss6 Rat phenobarbital affects expression ISO TMPRSS6 (Homo sapiens) 6480464 Phenobarbital affects the expression of TMPRSS6 mRNA CTD PMID:19159669 Tmprss6 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of TMPRSS6 mRNA CTD PMID:30047161 Tmprss6 Rat propiconazole decreases expression ISO Tmprss6 (Mus musculus) 6480464 propiconazole results in decreased expression of TMPRSS6 mRNA CTD PMID:21278054 Tmprss6 Rat quercetin multiple interactions ISO TMPRSS6 (Homo sapiens) 6480464 [Quercetin co-treated with Ascorbic Acid] results in decreased expression of TMPRSS6 mRNA CTD PMID:17639512 Tmprss6 Rat raloxifene affects response to substance ISO TMPRSS6 (Homo sapiens) 6480464 TMPRSS6 affects the susceptibility to Raloxifene Hydrochloride CTD PMID:32934756 Tmprss6 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO TMPRSS6 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of TMPRSS6 mRNA CTD PMID:35811015 Tmprss6 Rat selenium atom increases expression ISO TMPRSS6 (Homo sapiens) 6480464 Selenium results in increased expression of TMPRSS6 mRNA CTD PMID:19244175 Tmprss6 Rat sodium arsenite decreases expression ISO TMPRSS6 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of TMPRSS6 mRNA CTD PMID:29301061 Tmprss6 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of TMPRSS6 mRNA CTD PMID:30047161 Tmprss6 Rat tetrachloromethane decreases expression ISO Tmprss6 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of TMPRSS6 mRNA CTD PMID:27339419 and PMID:31919559 Tmprss6 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of TMPRSS6 mRNA CTD PMID:31150632 Tmprss6 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of TMPRSS6 mRNA] CTD PMID:31150632 Tmprss6 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of TMPRSS6 mRNA CTD PMID:23411599 and PMID:34492290 Tmprss6 Rat thioacetamide multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in decreased expression of TMPRSS6 mRNA CTD PMID:28943392 Tmprss6 Rat titanium dioxide increases expression ISO Tmprss6 (Mus musculus) 6480464 titanium dioxide results in increased expression of TMPRSS6 mRNA CTD PMID:35295148 Tmprss6 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of TMPRSS6 mRNA CTD PMID:33387578 Tmprss6 Rat valproic acid decreases expression ISO TMPRSS6 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of TMPRSS6 mRNA CTD PMID:29154799 Tmprss6 Rat vitamin E increases expression ISO TMPRSS6 (Homo sapiens) 6480464 Vitamin E results in increased expression of TMPRSS6 mRNA CTD PMID:19244175
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 17alpha-ethynylestradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (EXP) 3,3',4,4'-tetrachlorobiphenyl (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (EXP) acetamide (EXP) acrylamide (EXP) aflatoxin B1 (EXP,ISO) aristolochic acid A (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) buta-1,3-diene (ISO) CGP 52608 (ISO) Cuprizon (EXP) diethylstilbestrol (EXP) elemental selenium (ISO) fenthion (ISO) formaldehyde (ISO) furan (EXP) gentamycin (EXP) iron atom (ISO) iron(0) (ISO) L-ascorbic acid (ISO) lipopolysaccharide (ISO) methapyrilene (ISO) methidathion (ISO) N-nitrosodiethylamine (EXP) N-Nitrosopyrrolidine (ISO) O-methyleugenol (ISO) ozone (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) pregnenolone 16alpha-carbonitrile (EXP) propiconazole (ISO) quercetin (ISO) raloxifene (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) selenium atom (ISO) sodium arsenite (ISO) sulfadimethoxine (EXP) tetrachloromethane (EXP,ISO) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP) valproic acid (ISO) vitamin E (ISO)
Tmprss6 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 111,871,504 - 111,902,127 (-) NCBI GRCr8 mRatBN7.2 7 109,991,008 - 110,021,626 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 109,985,931 - 110,021,624 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 111,741,252 - 111,771,803 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 113,964,790 - 113,995,347 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 113,932,869 - 113,963,426 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 119,659,323 - 119,689,953 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 119,659,324 - 119,689,938 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 119,649,831 - 119,680,259 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 116,391,730 - 116,419,671 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 116,425,992 - 116,456,922 (-) NCBI Celera 7 106,329,190 - 106,359,893 (-) NCBI Celera Cytogenetic Map 7 q34 NCBI
TMPRSS6 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 22 37,065,436 - 37,110,536 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 22 37,065,436 - 37,109,713 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 22 37,461,476 - 37,505,753 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 22 35,791,425 - 35,829,639 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 22 35,785,978 - 35,824,193 NCBI Celera 22 21,262,809 - 21,300,772 (-) NCBI Celera Cytogenetic Map 22 q12.3 NCBI HuRef 22 20,426,706 - 20,464,791 (-) NCBI HuRef CHM1_1 22 37,420,983 - 37,458,920 (-) NCBI CHM1_1 T2T-CHM13v2.0 22 37,525,034 - 37,570,488 (-) NCBI T2T-CHM13v2.0
Tmprss6 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 78,323,867 - 78,352,848 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 78,323,867 - 78,352,834 (-) Ensembl GRCm39 Ensembl GRCm38 15 78,439,667 - 78,468,648 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 78,439,667 - 78,468,634 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 78,270,097 - 78,299,064 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 78,266,931 - 78,295,735 (-) NCBI MGSCv36 mm8 Celera 15 79,902,371 - 79,931,350 (-) NCBI Celera Cytogenetic Map 15 E1 NCBI cM Map 15 37.49 NCBI
Tmprss6 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955413 23,580,530 - 23,612,276 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955413 23,579,946 - 23,615,277 (-) NCBI ChiLan1.0 ChiLan1.0
TMPRSS6 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 23 46,921,683 - 46,967,316 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 22 49,610,237 - 49,655,886 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 22 17,979,094 - 18,032,590 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 22 35,815,051 - 35,867,818 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 22 35,815,051 - 35,859,940 (-) Ensembl panpan1.1 panPan2
TMPRSS6 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 27,393,650 - 27,435,893 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 27,397,123 - 27,435,908 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 27,353,491 - 27,390,639 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 28,190,798 - 28,228,167 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 28,190,967 - 28,228,124 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 27,912,441 - 27,949,753 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 28,221,179 - 28,258,351 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 28,399,083 - 28,436,250 (+) NCBI UU_Cfam_GSD_1.0
Tmprss6 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 10,804,553 - 10,838,236 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936492 3,819,309 - 3,848,075 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936492 3,819,347 - 3,848,372 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TMPRSS6 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 10,663,635 - 10,705,471 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 10,663,491 - 10,704,583 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 8,263,703 - 8,304,970 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TMPRSS6 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 19 19,771,303 - 19,811,751 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 19 19,771,952 - 19,806,420 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 106,017,797 - 106,057,808 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tmprss6
.
Predicted Target Of
Count of predictions: 82 Count of miRNA genes: 66 Interacting mature miRNAs: 76 Transcripts: ENSRNOT00000000200 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 1331728 Bp214 Blood pressure QTL 214 2.825 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 80221299 124373579 Rat 1331731 Bp216 Blood pressure QTL 216 2.851 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 102297359 133492884 Rat 2298475 Eau6 Experimental allergic uveoretinitis QTL 6 0.0029 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 7 84257275 129257275 Rat 71114 Niddm14 Non-insulin dependent diabetes mellitus QTL 14 4.5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 7 84257275 129257275 Rat 1357336 Gluco6 Glucose level QTL 6 3.4 blood glucose amount (VT:0000188) serum glucose level (CMO:0000543) 7 94811326 116294265 Rat 1357338 Stl17 Serum triglyceride level QTL 17 3.23 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 69736356 112729554 Rat 631687 Hcas1 Hepatocarcinoma susceptibility QTL 1 3.9 0.001 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 7 91412594 129807172 Rat 70159 Bp61 Blood pressure QTL 61 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 103146217 116738842 Rat 634331 Pia17 Pristane induced arthritis QTL 17 4.7 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 7 73829340 130221005 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 634322 Bw12 Body weight QTL 12 0 body mass (VT:0001259) body weight (CMO:0000012) 7 83153392 128153392 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 1549899 Stresp8 Stress response QTL 8 4.37 0.0008 stress-related behavior trait (VT:0010451) defensive burying duration (CMO:0001961) 7 90482196 135012528 Rat 2317052 Aia17 Adjuvant induced arthritis QTL 17 2.13 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 7 81737938 126737938 Rat 731176 Glom5 Glomerulus QTL 5 2.5 0.0035 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 7 96670164 135012528 Rat 7411607 Foco15 Food consumption QTL 15 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2306821 Bp335 Blood pressure QTL 335 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 106571501 135012528 Rat 1558655 Swd4 Spike wave discharge measurement QTL 4 3.68 0.0002 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge severity grade (CMO:0001988) 7 86983365 131983365 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 1331768 Kidm10 Kidney mass QTL 10 4.62096 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 80221299 125221299 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 2313102 Bmd79 Bone mineral density QTL 79 2.3 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 7 94811085 116738842 Rat 731174 Uae23 Urinary albumin excretion QTL 23 2.4 0.0042 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 7 104603555 135012528 Rat 2316947 Rf58 Renal function QTL 58 7.8 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 7 68938720 113886318 Rat 1331746 Kidm9 Kidney mass QTL 9 3.934 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 7 80221299 112308525 Rat 7411654 Foco25 Food consumption QTL 25 9.3 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2316955 Stl24 Serum triglyceride level QTL 24 7.1 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 7 68938720 113886318 Rat 2299163 Iddm34 Insulin dependent diabetes mellitus QTL 34 2.71 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 7 91281130 135012528 Rat 2316952 Pur22 Proteinuria QTL 22 5.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 7 68938720 113886318 Rat 631540 Bw9 Body weight QTL 9 4.5 body mass (VT:0001259) body weight (CMO:0000012) 7 69736226 117455174 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
D3Rat170
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 7 111,901,380 - 111,901,508 (+) Marker Load Pipeline mRatBN7.2 7 110,020,888 - 110,021,016 (+) MAPPER mRatBN7.2 Rnor_6.0 7 119,689,203 - 119,689,330 NCBI Rnor6.0 Rnor_5.0 7 119,679,522 - 119,679,649 UniSTS Rnor5.0 Celera 7 106,359,157 - 106,359,285 UniSTS RH 3.4 Map 7 815.9 RGD RH 3.4 Map 7 815.9 UniSTS SHRSP x BN Map 3 47.2998 RGD SHRSP x BN Map 3 47.2998 UniSTS Cytogenetic Map 7 q34 UniSTS
RH135327
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 110,008,637 - 110,008,839 (+) MAPPER mRatBN7.2 Rnor_6.0 7 119,676,952 - 119,677,153 NCBI Rnor6.0 Rnor_5.0 7 119,667,271 - 119,667,472 UniSTS Rnor5.0 RGSC_v3.4 7 116,410,914 - 116,411,115 UniSTS RGSC3.4 Celera 7 106,346,903 - 106,347,104 UniSTS RH 3.4 Map 7 816.5 UniSTS Cytogenetic Map 7 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
38
83
91
90
59
25
59
6
199
85
63
38
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000000200 ⟹ ENSRNOP00000000200
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 109,991,009 - 110,017,384 (-) Ensembl Rnor_6.0 Ensembl 7 119,659,324 - 119,689,938 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000097438 ⟹ ENSRNOP00000080392
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 109,990,993 - 110,021,624 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000103139 ⟹ ENSRNOP00000095497
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 109,985,931 - 110,021,624 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000109455 ⟹ ENSRNOP00000095053
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 109,993,755 - 110,017,384 (-) Ensembl
RefSeq Acc Id:
NM_001130556 ⟹ NP_001124028
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 111,871,505 - 111,902,116 (-) NCBI mRatBN7.2 7 109,991,009 - 110,021,624 (-) NCBI Rnor_6.0 7 119,659,324 - 119,689,938 (-) NCBI Rnor_5.0 7 119,649,831 - 119,680,259 (-) NCBI RGSC_v3.4 7 116,391,730 - 116,419,671 (-) RGD Celera 7 106,329,190 - 106,359,893 (-) RGD
Sequence:
ATTGTCCGTCCTGGACCTGACAGGAGGCCCATGGAACTTGGGGCCACAGGCCACGAGGGACAAGGGCCAGACACCCCAGTCATGGTTCCAGGCTATTGATCCAACCTAAGCTGGCCAGTTGTGGGTGG
hide sequence
RefSeq Acc Id:
XM_006241995 ⟹ XP_006242057
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 111,871,504 - 111,902,125 (-) NCBI mRatBN7.2 7 109,991,008 - 110,021,625 (-) NCBI Rnor_6.0 7 119,659,323 - 119,689,953 (-) NCBI Rnor_5.0 7 119,649,831 - 119,680,259 (-) NCBI
Sequence:
CCTGTGTTCAGTTACATTGTCCGTCCTGGACCTGACAGGAGGCCCATGGAACTTGGGGCCACAG
hide sequence
RefSeq Acc Id:
XM_006241996 ⟹ XP_006242058
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 111,871,504 - 111,902,127 (-) NCBI mRatBN7.2 7 109,991,536 - 110,021,626 (-) NCBI Rnor_6.0 7 119,659,323 - 119,689,953 (-) NCBI Rnor_5.0 7 119,649,831 - 119,680,259 (-) NCBI
Sequence:
CCTGTGTTCAGTTACATTGTCCGTCCTGGACCTGACAGGAGGCCCATGGAACTTGGGGCCACAG
hide sequence
RefSeq Acc Id:
NP_001124028 ⟸ NM_001130556
- UniProtKB:
D3ZF49 (UniProtKB/TrEMBL), A6HSK5 (UniProtKB/TrEMBL), A0A8I6ANM9 (UniProtKB/TrEMBL)
- Sequence:
MPRCFQLPCSTRMPTAEVPQAAGGQGDGGDGEEAAEPEGVFKAPRNAKRKDRDYVRFTPLLLVLAALASAGVMLWYFLGYKAEVTISQVYSGSLRVLNRHFSQDLARRESIAFRTETAKAQKMFQELV
hide sequence
RefSeq Acc Id:
XP_006242058 ⟸ XM_006241996
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6G6J0 (UniProtKB/TrEMBL), A0A8I6ANM9 (UniProtKB/TrEMBL)
- Sequence:
MPTAEVPQAAGGQGDGGDGEEAAEPEGVFKAPRNAKRKDRDYVRFTPLLLVLAALASAGVMLWY
hide sequence
RefSeq Acc Id:
XP_006242057 ⟸ XM_006241995
- Peptide Label:
isoform X1
- UniProtKB:
A6HSK7 (UniProtKB/TrEMBL), A0A8I6ANM9 (UniProtKB/TrEMBL)
- Sequence:
MPRCFQLPCSTRMPTAEVPQAAGGQGDGGDGEEAAEPEGVFKAPRNAKRKDRDYVRFTPLLLVLAALASAGVMLWYFLGYKAEVTISQVYSGSLRVLNRHFSQDLARRESIAFRTETAKAQKMFQELV
hide sequence
Ensembl Acc Id:
ENSRNOP00000000200 ⟸ ENSRNOT00000000200
Ensembl Acc Id:
ENSRNOP00000095497 ⟸ ENSRNOT00000103139
Ensembl Acc Id:
ENSRNOP00000080392 ⟸ ENSRNOT00000097438
Ensembl Acc Id:
ENSRNOP00000095053 ⟸ ENSRNOT00000109455
RGD ID: 13695462 Promoter ID: EPDNEW_R5987 Type: multiple initiation site Name: Tmprss6_1 Description: transmembrane protease, serine 6 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 119,689,944 - 119,690,004 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2018-01-26
Tmprss6
transmembrane serine protease 6
Tmprss6
transmembrane protease, serine 6
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-11-20
Tmprss6
transmembrane protease, serine 6
Tmprss6
transmembrane serine protease 6
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Tmprss6
transmembrane serine protease 6
Tmprss6_predicted
transmembrane serine protease 6 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Tmprss6_predicted
transmembrane serine protease 6 (predicted)
Symbol and Name status set to approved
70820 APPROVED
