Advanced Search (OLGA)

Gene: Spag8 (sperm associated antigen 8) Rattus norvegicus

Analyze

Symbol:

Spag8

Name:

sperm associated antigen 8

RGD ID:

1307079

Description:

Predicted to enable microtubule binding activity. Predicted to be involved in flagellated sperm motility and positive regulation of transcription by RNA polymerase II. Predicted to be located in axonemal microtubule and male germ cell nucleus. Predicted to be active in axonemal A tubule inner sheath; nucleus; and sperm flagellum. Orthologous to human SPAG8 (sperm associated antigen 8); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC362508; sperm-associated antigen 8

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SPAG8 (sperm associated antigen 8)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Spag8 (sperm associated antigen 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Spag8 (sperm associated antigen 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SPAG8 (sperm associated antigen 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SPAG8 (sperm associated antigen 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Spag8 (sperm associated antigen 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SPAG8 (sperm associated antigen 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SPAG8 (sperm associated antigen 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Spag8 (sperm associated antigen 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Spag8 (sperm associated antigen 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ENO4 (enolase 4)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	SPAG8 (sperm associated antigen 8)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Spag8 (sperm associated antigen 8)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	spag8	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	spag8	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	62,697,451 - 62,699,664 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	62,693,122 - 62,699,664 (-)	Ensembl				GRCr8
mRatBN7.2	5	57,901,681 - 57,903,894 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	57,901,682 - 57,903,894 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	59,881,766 - 59,883,979 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	61,700,580 - 61,702,793 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	61,671,784 - 61,674,016 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	59,147,412 - 59,149,625 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	59,147,337 - 59,149,699 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	63,672,204 - 63,674,417 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	60,128,061 - 60,130,253 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	56,482,149 - 56,484,362 (-)	NCBI		Celera
RGSC_v3.1	5	60,128,239 - 60,130,453 (-)	NCBI
Cytogenetic Map	5	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Leber congenital amaurosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrylamide (EXP,ISO)

aflatoxin B1 (ISO)

amphotericin B (ISO)

benzo[a]pyrene (ISO)

beta-naphthoflavone (ISO)

bisphenol A (EXP)

Butylbenzyl phthalate (ISO)

CGP 52608 (ISO)

chloroprene (ISO)

cisplatin (ISO)

Cuprizon (EXP)

glycidol (EXP)

ivermectin (ISO)

methamphetamine (EXP)

ozone (ISO)

paracetamol (ISO)

phenobarbital (ISO)

SCH 23390 (EXP)

sodium arsenite (ISO)

sunitinib (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

urethane (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

flagellated sperm motility (ISO)

positive regulation of transcription by RNA polymerase II (IBA,ISO)

Cellular Component

axonemal A tubule inner sheath (ISO)

axonemal microtubule (IEA,ISO)

cilium (IEA,ISO)

cytoplasm (IBA,ISO)

nucleus (IBA,ISO)

sperm flagellum (ISO)

Molecular Function

microtubule binding (IEA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:20488182

Genomics

Comparative Map Data

Spag8
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	62,697,451 - 62,699,664 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	62,693,122 - 62,699,664 (-)	Ensembl				GRCr8
mRatBN7.2	5	57,901,681 - 57,903,894 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	57,901,682 - 57,903,894 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	59,881,766 - 59,883,979 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	61,700,580 - 61,702,793 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	61,671,784 - 61,674,016 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	59,147,412 - 59,149,625 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	59,147,337 - 59,149,699 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	63,672,204 - 63,674,417 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	60,128,061 - 60,130,253 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	56,482,149 - 56,484,362 (-)	NCBI		Celera
RGSC_v3.1	5	60,128,239 - 60,130,453 (-)	NCBI
Cytogenetic Map	5	q22	NCBI

SPAG8
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	35,807,785 - 35,812,262 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	35,808,045 - 35,812,272 (-)	Ensembl			hg38	GRCh38
GRCh37	9	35,807,782 - 35,812,259 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	35,797,782 - 35,802,259 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	9	35,797,781 - 35,802,259	NCBI
Celera	9	35,741,314 - 35,745,791 (-)	NCBI		Celera
Cytogenetic Map	9	p13.3	NCBI
HuRef	9	35,763,806 - 35,768,271 (-)	NCBI		HuRef
CHM1_1	9	35,808,170 - 35,812,647 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	9	35,828,452 - 35,832,929 (-)	NCBI		T2T-CHM13v2.0

Spag8
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	43,651,330 - 43,653,594 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	43,651,335 - 43,653,594 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	4	43,651,330 - 43,653,594 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	43,651,335 - 43,653,594 (-)	Ensembl			mm10	GRCm38
MGSCv37	4	43,664,601 - 43,666,424 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	4	43,672,829 - 43,674,652 (-)	NCBI		MGSCv36	mm8
Celera	4	43,686,334 - 43,688,157 (-)	NCBI		Celera
Cytogenetic Map	4	A5	NCBI
cM Map	4	23.05	NCBI

Spag8
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955472	504,087 - 505,835 (+)	Ensembl
ChiLan1.0	NW_004955472	503,286 - 506,261 (+)	NCBI	ChiLan1.0	ChiLan1.0

SPAG8
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	88,776,425 - 88,781,041 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	88,782,356 - 88,787,361 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	35,658,541 - 35,662,920 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	36,460,951 - 36,465,112 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	36,460,951 - 36,465,112 (-)	Ensembl			panPan2	panpan1.1

SPAG8
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	52,339,338 - 52,341,642 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	52,339,339 - 52,341,522 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	50,906,909 - 50,909,213 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	53,404,355 - 53,406,659 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	53,404,356 - 53,406,539 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	51,948,863 - 51,951,167 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	51,933,087 - 51,935,391 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	52,634,545 - 52,636,849 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Spag8
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	167,214,302 - 167,253,806 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936524	3,798,281 - 3,800,704 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936524	3,798,144 - 3,801,479 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SPAG8
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	236,529,269 - 236,534,734 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	1	236,526,659 - 236,532,181 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	264,254,276 - 264,257,231 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SPAG8
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	44,792,661 - 44,795,736 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	44,793,253 - 44,800,474 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666038	41,897,315 - 41,900,388 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Spag8
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624868	4,972,286 - 4,974,442 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624868	4,971,510 - 4,974,601 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Spag8
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	2,848,587 - 2,850,719 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Spag8
12 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	30
Count of miRNA genes:	27
Interacting mature miRNAs:	30
Transcripts:	ENSRNOT00000040641
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578776	Stresp18	Stress response QTL 18	2.9		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	5	32751649	77751649	Rat
1298067	Scl15	Serum cholesterol level QTL 15	4.8	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	38011670	83011670	Rat
1300115	Hrtrt7	Heart rate QTL 7	2.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	52665372	94894052	Rat
6907115	Mcs29	Mammary carcinoma susceptibility QTL 29			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	38004331	83004331	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	44924861	153890773	Rat
1358353	Srcrtb2	Stress Responsive Cort Basal QTL 2	3.48	0.003	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	23671493	79046465	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	38207390	136631402	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	48523123	134369373	Rat
1598807	Glom12	Glomerulus QTL 12	2.7		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	38011670	83011670	Rat
1302786	Kidm8	Kidney mass QTL 8	28.15		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	38011670	83011670	Rat
1331782	Rf36	Renal function QTL 36	3.296		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	39019942	102105896	Rat
6903292	Stl28	Serum triglyceride level QTL 28	2.6	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	5	33311673	78311673	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	51657967	166600247	Rat
1578767	Stresp17	Stress response QTL 17	4.3	0.01	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	5	32751649	77751649	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55124766	172190305	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	39985948	84985948	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	6922282	81330203	Rat
6903306	Scl35	Serum cholesterol QTL 35	2.6	0.0073	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	33311673	78311673	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	39526924	84526924	Rat
1331773	Scl26	Serum cholesterol level QTL 26	3.065		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	48523123	91770353	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	60601597	137492949	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	10019064	91770353	Rat
61359	Eaex	Experimental allergic encephalomyelitis QTL x	3		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	5	60511627	105511627	Rat
8662454	Vetf3	Vascular elastic tissue fragility QTL 3	27.4		artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	5	7065535	74335773	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	36460764	136631402	Rat
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	10019064	87027358	Rat
8552954	Pigfal14	Plasma insulin-like growth factor 1 level QTL 14	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	26023211	71023211	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	56546393	101546393	Rat
1600358	Mamtr5	Mammary tumor resistance QTL 5			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	23671493	68671493	Rat

Markers in Region

RH141203

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	57,901,764 - 57,901,982 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	59,147,496 - 59,147,713	NCBI	Rnor6.0
Rnor_5.0	5	63,672,288 - 63,672,505	UniSTS	Rnor5.0
RGSC_v3.4	5	60,128,145 - 60,128,362	UniSTS	RGSC3.4
Celera	5	56,482,233 - 56,482,450	UniSTS
RH 3.4 Map	5	395.0	UniSTS
Cytogenetic Map	5	q22	UniSTS

RH141379

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	57,901,334 - 57,901,535 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	59,147,066 - 59,147,266	NCBI	Rnor6.0
Rnor_5.0	5	63,671,858 - 63,672,058	UniSTS	Rnor5.0
RGSC_v3.4	5	60,127,715 - 60,127,915	UniSTS	RGSC3.4
Celera	5	56,481,803 - 56,482,003	UniSTS
RH 3.4 Map	5	395.6	UniSTS
Cytogenetic Map	5	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	65	163	91	90	59	86	59	6	347	184	11	142	80	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001173555	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039110227	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC121204	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC079031	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473962	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000040641 ⟹ ENSRNOP00000050314

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	62,693,122 - 62,699,664 (-)	Ensembl
mRatBN7.2 Ensembl	5	57,901,682 - 57,903,894 (-)	Ensembl
Rnor_6.0 Ensembl	5	59,147,413 - 59,149,625 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000084216 ⟹ ENSRNOP00000069102

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	5	59,147,337 - 59,149,699 (-)	Ensembl

RefSeq Acc Id:

NM_001173555 ⟹ NP_001167026

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	62,697,451 - 62,699,664 (-)	NCBI
mRatBN7.2	5	57,901,681 - 57,903,894 (-)	NCBI
Rnor_6.0	5	59,147,412 - 59,149,625 (-)	NCBI
Rnor_5.0	5	63,672,204 - 63,674,417 (-)	NCBI
Celera	5	56,482,149 - 56,484,362 (-)	NCBI

Sequence:

show sequence

CCCGGTAGGCGGAGTCTGAAAATGGAGACCACCGACTCCACAGAGGGATCTTTGACACGATCTT
TTGATATACAGCCCAGCTCTGAAGGACTAGAGTCCACTTCAGAACCCATTCCTTCTTCGGGTAG
CAGTCCTAAGCCTACCGTACAGACCGGAGCTGCCCCATCATCTGCAGTATGTCGAGGAGTTCCT
TCGCCGTATTGTGTGTTTACAGATCCCTCCTCTGACAGTCTTTATGAAGCAACCTGCCCCGCAC
CCCATCCGAGGGGCCATGGGAGGTTTGGCTTTCAGCCCCTCTATGTTTCTTATATTCCTCGGGA
TCCCTGTAATACCGCAGACCTCAGCTCAAACCCTGATCCTGCCACTTCTTATCCTTGCCATAGC
TCTGTTCATAGCTCTGTCTCTGGCTCTGGCCCTTGTTTTGGTGTTAGCTCTGAGCCTAGCCAGG
GCTCGGGTCCCACCTCTGGGCCTGTTCCTGTCTCTGGACCTAGTCTTGTCTCTGGACCTGCTTC
TGTCTCTGGACCCGATTCTTCTTCCTCTGGAACTGCTCTTGCCCCTGGACCCGGTCTTCCTCCT
AGACCTGAGCCTGCTGAGCCTGTACCTGGAACTAAGCTCAGGACCTACATTCCTCAAGGATTCA
AATGCATCCCAATAGATCTGTTCCCTAATTGGGGTCAGAACATACACTGGAAGCCGCAACACAC
CTGGGAACCTGTACAAGTCAGGGAACCTGGAGTAAGAGGGCCACGTAAACGTCCAGAGGTTGAA
TATGAGAAAATTCTCTGCAAAGCACAGCCACGTGGCCAGTGTCTCCTCTACAACTGGCAGGAAG
AGAGAGCCACCAACCAGCTGGATCAAATCCCACCATTGCAAGACGGCTCAGAGAGTTATTTCTT
CCGACACGGACACCAGGGTCTGCTGACCTTGCAACCTCAGTTGCCCATGCCTTCTAGCACCACC
CAGAAAGACTCATACCAGCTCCCAAGACACACCTGTTATCCACTTCGAGGGAAGCGTGAAGCCA
TGCTGGAGATACTCCTGCAACACCAGATCTGTAAAGAGGTGCAGAGAGAGCAGGAGCCTACAAG
GAAACTCTCTGAGACCGAGTCGGTAACACACCATGACTACAGAGTGGAGCTGGTAGGAACAGGG
CCTCCTGCCCCAACAAAGCCTCATGATTACCGCCAGGAACAGCCTGAAACCTTCTGGATACAGC
ACGCAGCACAGCTACGGGGTGTCAATAGCATCAGGACACTGGACACTCCATTCCGGAAGAACTA
CAGCTTCTCAACACCAGCATCCTTGTCGCTGGGGCAGCCTTTGCCTTACGAACTGGAGAACAGC
CCCCACCAAATGGGGGTAATGTCTTCCCTTGCCTGTCAGGGAGGGCAGGGGGATAGAAGGAAGA
GAACAACTCCATTCTAAGTATTGAGGTGGGAAGCAGACATGGGATTTGGAATCCATTTCTATTT
ATACTACAGACGTACTTTGGATGGAGTTGATTCTCTGTCCTTGATGTAGGTTTTACATAAAGCA
CTCTCATCCTGCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039110227 ⟹ XP_038966155

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	62,697,451 - 62,698,837 (-)	NCBI
mRatBN7.2	5	57,901,681 - 57,903,100 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001167026	(Get FASTA)	NCBI Sequence Viewer
	XP_038966155	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79031	(Get FASTA)	NCBI Sequence Viewer
	EDL98762	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000050314
	ENSRNOP00000050314.4

RefSeq Acc Id:

NP_001167026 ⟸ NM_001173555

- UniProtKB:

F7EV11 (UniProtKB/TrEMBL), Q6AYI6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

METTDSTEGSLTRSFDIQPSSEGLESTSEPIPSSGSSPKPTVQTGAAPSSAVCRGVPSPYCVFT
DPSSDSLYEATCPAPHPRGHGRFGFQPLYVSYIPRDPCNTADLSSNPDPATSYPCHSSVHSSVS
GSGPCFGVSSEPSQGSGPTSGPVPVSGPSLVSGPASVSGPDSSSSGTALAPGPGLPPRPEPAEP
VPGTKLRTYIPQGFKCIPIDLFPNWGQNIHWKPQHTWEPVQVREPGVRGPRKRPEVEYEKILCK
AQPRGQCLLYNWQEERATNQLDQIPPLQDGSESYFFRHGHQGLLTLQPQLPMPSSTTQKDSYQL
PRHTCYPLRGKREAMLEILLQHQICKEVQREQEPTRKLSETESVTHHDYRVELVGTGPPAPTKP
HDYRQEQPETFWIQHAAQLRGVNSIRTLDTPFRKNYSFSTPASLSLGQPLPYELENSPHQMGVM
SSLACQGGQGDRRKRTTPF

hide sequence

Ensembl Acc Id:

ENSRNOP00000069102 ⟸ ENSRNOT00000084216

Ensembl Acc Id:

ENSRNOP00000050314 ⟸ ENSRNOT00000040641

RefSeq Acc Id:	XP_038966155 ⟸ XM_039110227
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F7EV11-F1-model_v2	AlphaFold	F7EV11	1-467	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693680

Promoter ID:

EPDNEW_R4205

Type:

initiation region

Name:

Spag8_1

Description:

sperm associated antigen 8

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	59,149,615 - 59,149,675	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307079	AgrOrtholog
BioCyc Gene	G2FUF-41498	BioCyc
Ensembl Genes	ENSRNOG00000032539	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000040641	ENTREZGENE
	ENSRNOT00000040641.4	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7114255	IMAGE-MGC_LOAD
InterPro	Sperm-assoc_Ag8	UniProtKB/TrEMBL
KEGG Report	rno:362508	UniProtKB/TrEMBL
MGC_CLONE	MGC:93959	IMAGE-MGC_LOAD
NCBI Gene	362508	ENTREZGENE
PANTHER	PTHR15510	UniProtKB/TrEMBL
	SPERM-ASSOCIATED ANTIGEN 8	UniProtKB/TrEMBL
Pfam	CFAP143	UniProtKB/TrEMBL
PhenoGen	Spag8	PhenoGen
RatGTEx	ENSRNOG00000032539	RatGTEx
UniProt	A6IJ42_RAT	UniProtKB/TrEMBL
	F7EV11	ENTREZGENE, UniProtKB/TrEMBL
	Q6AYI6	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-12-06	Spag8	sperm associated antigen 8	Spag8_predicted	sperm associated antigen 8 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Spag8_predicted	sperm associated antigen 8 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar