Symbol:
Vil1
Name:
villin 1
RGD ID:
1307048
Description:
Predicted to enable several functions, including cysteine-type endopeptidase inhibitor activity involved in apoptotic process; phospholipid binding activity; and protein homodimerization activity. Predicted to be involved in several processes, including actin cytoskeleton organization; regulation of actin filament organization; and regulation of cell morphogenesis. Predicted to be located in several cellular components, including brush border; filopodium tip; and ruffle. Orthologous to human VIL1 (villin 1); INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 3,3',5,5'-tetrabromobisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC316521; Vil; villin; villin-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
VIL1 (villin 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Vil1 (villin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Vil1 (villin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
VIL1 (villin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
VIL1 (villin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Vil1 (villin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
VIL1 (villin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
VIL1 (villin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Vil1 (villin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
VIL1 (villin 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Vil1 (villin 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
vil1 (villin 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Gel
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
gsnl-1
Alliance
DIOPT (OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
qua
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
vil1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 83,440,248 - 83,467,963 (+) NCBI GRCr8 mRatBN7.2 9 75,991,141 - 76,018,860 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 75,991,141 - 76,018,858 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 84,436,168 - 84,463,861 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 89,565,114 - 89,592,807 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 87,951,296 - 87,978,989 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 81,689,802 - 81,717,623 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 81,689,802 - 81,717,621 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 81,454,351 - 81,482,172 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 73,748,632 - 73,776,347 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 73,895,763 - 73,923,376 (+) NCBI Celera 9 73,564,428 - 73,592,138 (+) NCBI Celera Cytogenetic Map 9 q33 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Vil1 Rat 1,2-dimethylhydrazine decreases expression ISO Vil1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of VIL1 mRNA CTD PMID:22206623 Vil1 Rat 1,2-dimethylhydrazine multiple interactions ISO Vil1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of VIL1 mRNA CTD PMID:22206623 Vil1 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of VIL1 mRNA CTD PMID:30723492 Vil1 Rat 17beta-estradiol decreases expression ISO VIL1 (Homo sapiens) 6480464 Estradiol results in decreased expression of VIL1 mRNA CTD PMID:20106945 Vil1 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of VIL1 mRNA CTD PMID:32145629 Vil1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Vil1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of VIL1 mRNA CTD PMID:19770486 Vil1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO VIL1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of VIL1 mRNA CTD PMID:20106945 and PMID:21632981 Vil1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Vil1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of VIL1 mRNA CTD PMID:21570461 Vil1 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression ISO VIL1 (Homo sapiens) 6480464 3 more ... CTD PMID:23146750 Vil1 Rat 3,3',5,5'-tetrabromobisphenol A multiple interactions EXP 6480464 N-(N-(3 and 5-difluorophenacetyl)alanyl)phenylglycine tert-butyl ester inhibits the reaction [tetrabromobisphenol A results in increased expression of VIL1 mRNA] CTD PMID:32041402 Vil1 Rat 3,3',5,5'-tetrabromobisphenol A increases expression EXP 6480464 tetrabromobisphenol A results in increased expression of VIL1 mRNA CTD PMID:32041402 Vil1 Rat 4,4'-sulfonyldiphenol increases expression ISO Vil1 (Mus musculus) 6480464 bisphenol S results in increased expression of VIL1 mRNA CTD PMID:30951980 Vil1 Rat 4-hydroxyphenyl retinamide increases expression ISO Vil1 (Mus musculus) 6480464 Fenretinide results in increased expression of VIL1 mRNA CTD PMID:28973697 Vil1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of VIL1 mRNA CTD PMID:31881176 Vil1 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of VIL1 mRNA CTD PMID:28959563 Vil1 Rat aflatoxin B1 decreases expression ISO Vil1 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of VIL1 mRNA CTD PMID:19770486 Vil1 Rat andrographolide multiple interactions ISO Vil1 (Mus musculus) 6480464 [andrographolide co-treated with beta-Naphthoflavone] results in decreased expression of VIL1 mRNA CTD PMID:19737545 Vil1 Rat antirheumatic drug increases expression ISO VIL1 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of VIL1 mRNA CTD PMID:24449571 Vil1 Rat arsenic acid decreases expression ISO VIL1 (Homo sapiens) 6480464 arsenic acid results in decreased expression of VIL1 mRNA CTD PMID:29355690 Vil1 Rat arsenous acid decreases expression ISO VIL1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of VIL1 mRNA CTD PMID:29355690 Vil1 Rat benzo[a]pyrene multiple interactions ISO Vil1 (Mus musculus) 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to VIL1 promoter] CTD PMID:19654925 Vil1 Rat benzo[a]pyrene decreases expression ISO VIL1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of VIL1 mRNA CTD PMID:32234424 Vil1 Rat benzo[a]pyrene decreases expression ISO Vil1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of VIL1 mRNA CTD PMID:19770486 Vil1 Rat benzo[b]fluoranthene increases expression ISO Vil1 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of VIL1 mRNA CTD PMID:26377693 Vil1 Rat beta-lapachone decreases expression ISO VIL1 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of VIL1 mRNA CTD PMID:38218311 Vil1 Rat beta-naphthoflavone multiple interactions ISO Vil1 (Mus musculus) 6480464 [andrographolide co-treated with beta-Naphthoflavone] results in decreased expression of VIL1 mRNA CTD PMID:19737545 Vil1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Vil1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of VIL1 mRNA CTD PMID:36209858 Vil1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Vil1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of VIL1 protein CTD PMID:36209858 Vil1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of VIL1 mRNA CTD PMID:25181051 Vil1 Rat bisphenol A increases expression ISO Vil1 (Mus musculus) 6480464 bisphenol A results in increased expression of VIL1 mRNA CTD PMID:34585602 Vil1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of VIL1 mRNA CTD PMID:30816183 more ... Vil1 Rat bisphenol A affects expression ISO VIL1 (Homo sapiens) 6480464 bisphenol A affects the expression of VIL1 mRNA CTD PMID:30903817 Vil1 Rat butanal decreases expression ISO VIL1 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of VIL1 mRNA CTD PMID:26079696 Vil1 Rat caffeine affects phosphorylation ISO VIL1 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of VIL1 protein CTD PMID:35688186 Vil1 Rat chlorpyrifos increases expression ISO Vil1 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of VIL1 mRNA CTD PMID:34289071 Vil1 Rat choline multiple interactions ISO Vil1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of VIL1 mRNA CTD PMID:20938992 Vil1 Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of VIL1 mRNA CTD PMID:22023808 Vil1 Rat copper(II) sulfate decreases expression ISO VIL1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of VIL1 mRNA CTD PMID:19549813 Vil1 Rat cordycepin affects expression ISO VIL1 (Homo sapiens) 6480464 cordycepin affects the expression of VIL1 mRNA CTD PMID:28099944 Vil1 Rat cyclosporin A decreases expression ISO Vil1 (Mus musculus) 6480464 Cyclosporine results in decreased expression of VIL1 mRNA CTD PMID:19770486 Vil1 Rat cyclosporin A decreases expression ISO VIL1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of VIL1 mRNA CTD PMID:20106945 more ... Vil1 Rat DAPT multiple interactions EXP 6480464 N-(N-(3 and 5-difluorophenacetyl)alanyl)phenylglycine tert-butyl ester inhibits the reaction [tetrabromobisphenol A results in increased expression of VIL1 mRNA] CTD PMID:32041402 Vil1 Rat deoxynivalenol multiple interactions ISO Vil1 (Mus musculus) 6480464 lauric acid inhibits the reaction [deoxynivalenol results in decreased expression of VIL1 protein] CTD PMID:34506767 Vil1 Rat deoxynivalenol decreases expression ISO Vil1 (Mus musculus) 6480464 deoxynivalenol results in decreased expression of VIL1 protein CTD PMID:34506767 Vil1 Rat diarsenic trioxide decreases expression ISO VIL1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of VIL1 mRNA CTD PMID:29355690 Vil1 Rat dichloroacetic acid decreases expression ISO Vil1 (Mus musculus) 6480464 Dichloroacetic Acid results in decreased expression of VIL1 mRNA CTD PMID:28962523 Vil1 Rat dodecanoic acid multiple interactions ISO Vil1 (Mus musculus) 6480464 lauric acid inhibits the reaction [deoxynivalenol results in decreased expression of VIL1 protein] CTD PMID:34506767 Vil1 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of VIL1 mRNA CTD PMID:29391264 Vil1 Rat folic acid multiple interactions ISO Vil1 (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Vil1 Rat folic acid decreases expression ISO VIL1 (Homo sapiens) 6480464 Folic Acid results in decreased expression of VIL1 mRNA CTD PMID:21867686 Vil1 Rat furan increases expression EXP 6480464 furan results in increased expression of VIL1 mRNA CTD PMID:27387713 Vil1 Rat genistein decreases expression ISO Vil1 (Mus musculus) 6480464 Genistein results in decreased expression of VIL1 mRNA CTD PMID:32186404 Vil1 Rat L-methionine multiple interactions ISO Vil1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of VIL1 mRNA CTD PMID:20938992 Vil1 Rat MeIQx decreases expression ISO VIL1 (Homo sapiens) 6480464 2-amino-3 more ... CTD PMID:20816883 Vil1 Rat methotrexate increases expression ISO VIL1 (Homo sapiens) 6480464 Methotrexate results in increased expression of VIL1 mRNA CTD PMID:24449571 Vil1 Rat N-Nitrosopyrrolidine decreases expression ISO VIL1 (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in decreased expression of VIL1 mRNA CTD PMID:32234424 Vil1 Rat paracetamol decreases expression ISO VIL1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of VIL1 mRNA CTD PMID:21420995 and PMID:29067470 Vil1 Rat perfluorononanoic acid decreases expression ISO VIL1 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of VIL1 mRNA CTD PMID:32588087 Vil1 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of VIL1 mRNA CTD PMID:28511854 Vil1 Rat phenobarbital decreases expression ISO VIL1 (Homo sapiens) 6480464 Phenobarbital results in decreased expression of VIL1 mRNA CTD PMID:19084549 Vil1 Rat pirinixic acid increases expression ISO Vil1 (Mus musculus) 6480464 pirinixic acid results in increased expression of VIL1 mRNA CTD PMID:20813756 Vil1 Rat pirinixic acid decreases expression ISO Vil1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of VIL1 mRNA CTD PMID:23811191 Vil1 Rat quercetin decreases expression ISO VIL1 (Homo sapiens) 6480464 Quercetin results in decreased expression of VIL1 mRNA CTD PMID:21632981 Vil1 Rat silicon dioxide decreases expression ISO VIL1 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of VIL1 mRNA CTD PMID:25895662 Vil1 Rat silicon dioxide increases expression ISO VIL1 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of VIL1 mRNA CTD PMID:23806026 Vil1 Rat sodium arsenite decreases expression ISO VIL1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of VIL1 mRNA CTD PMID:29301061 Vil1 Rat sodium dichromate affects expression EXP 6480464 sodium bichromate affects the expression of VIL1 mRNA CTD PMID:22110744 Vil1 Rat tanespimycin increases expression ISO VIL1 (Homo sapiens) 6480464 tanespimycin analog results in increased expression of VIL1 protein CTD PMID:31370342 Vil1 Rat Theaflavin 3,3'-digallate affects expression ISO VIL1 (Homo sapiens) 6480464 theaflavin-3 and 3'-digallate affects the expression of VIL1 mRNA CTD PMID:34925699 Vil1 Rat titanium dioxide increases expression ISO Vil1 (Mus musculus) 6480464 titanium dioxide results in increased expression of VIL1 mRNA CTD PMID:35295148 Vil1 Rat tributylstannane increases expression ISO Vil1 (Mus musculus) 6480464 tributyltin results in increased expression of VIL1 mRNA CTD PMID:31939706 Vil1 Rat trichloroethene decreases expression ISO Vil1 (Mus musculus) 6480464 Trichloroethylene results in decreased expression of VIL1 mRNA CTD PMID:25549359 Vil1 Rat triclosan decreases expression ISO VIL1 (Homo sapiens) 6480464 Triclosan results in decreased expression of VIL1 mRNA CTD PMID:30510588 Vil1 Rat triphenyl phosphate affects expression ISO VIL1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of VIL1 mRNA CTD PMID:37042841 Vil1 Rat triptonide increases expression ISO Vil1 (Mus musculus) 6480464 triptonide results in increased expression of VIL1 mRNA CTD PMID:33045310 Vil1 Rat troglitazone increases expression ISO Vil1 (Mus musculus) 6480464 troglitazone results in increased expression of VIL1 mRNA CTD PMID:28973697 Vil1 Rat troglitazone increases expression ISO VIL1 (Homo sapiens) 6480464 troglitazone results in increased expression of VIL1 mRNA CTD PMID:14634802 Vil1 Rat troglitazone decreases expression ISO VIL1 (Homo sapiens) 6480464 troglitazone results in decreased expression of VIL1 mRNA CTD PMID:14634802 Vil1 Rat urethane decreases expression ISO VIL1 (Homo sapiens) 6480464 Urethane results in decreased expression of VIL1 mRNA CTD PMID:28818685 Vil1 Rat valproic acid increases methylation ISO VIL1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of VIL1 gene CTD PMID:29154799 Vil1 Rat valproic acid affects expression ISO VIL1 (Homo sapiens) 6480464 Valproic Acid affects the expression of VIL1 mRNA CTD PMID:25979313 Vil1 Rat valproic acid decreases expression ISO VIL1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of VIL1 mRNA CTD PMID:24935251 Vil1 Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of VIL1 gene CTD PMID:31079544
1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3,3',5,5'-tetrabromobisphenol A (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) acetamide (EXP) acrylamide (EXP) aflatoxin B1 (ISO) andrographolide (ISO) antirheumatic drug (ISO) arsenic acid (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) beta-lapachone (ISO) beta-naphthoflavone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) butanal (ISO) caffeine (ISO) chlorpyrifos (ISO) choline (ISO) cisplatin (EXP) copper(II) sulfate (ISO) cordycepin (ISO) cyclosporin A (ISO) DAPT (EXP) deoxynivalenol (ISO) diarsenic trioxide (ISO) dichloroacetic acid (ISO) dodecanoic acid (ISO) endosulfan (EXP) folic acid (ISO) furan (EXP) genistein (ISO) L-methionine (ISO) MeIQx (ISO) methotrexate (ISO) N-Nitrosopyrrolidine (ISO) paracetamol (ISO) perfluorononanoic acid (ISO) perfluorooctanoic acid (EXP) phenobarbital (ISO) pirinixic acid (ISO) quercetin (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium dichromate (EXP) tanespimycin (ISO) Theaflavin 3,3'-digallate (ISO) titanium dioxide (ISO) tributylstannane (ISO) trichloroethene (ISO) triclosan (ISO) triphenyl phosphate (ISO) triptonide (ISO) troglitazone (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP)
Biological Process
actin filament capping (IEA,ISO) actin filament depolymerization (IEA,ISO) actin filament polymerization (IEA,ISO) actin filament severing (IEA,ISO) barbed-end actin filament capping (IEA,ISO) biological_process (ND) cellular response to epidermal growth factor stimulus (IEA,ISO) cellular response to hepatocyte growth factor stimulus (IEA,ISO) cytoplasmic actin-based contraction involved in cell motility (IEA,ISO) cytoskeleton organization (IEA) epidermal growth factor receptor signaling pathway (IEA,ISO) epithelial cell differentiation (IEA,ISO) intestinal D-glucose absorption (IEA,ISO) microvillus assembly (ISO) positive regulation of actin filament bundle assembly (IEA,ISO) positive regulation of actin filament depolymerization (IEA,ISO) positive regulation of cell migration (IEA,ISO) positive regulation of epithelial cell migration (IEA,ISO) positive regulation of lamellipodium morphogenesis (IEA,ISO) positive regulation of multicellular organism growth (IEA,ISO) positive regulation of protein localization to plasma membrane (IEA,ISO) regulation of actin nucleation (IEA,ISO) regulation of cell shape (IEA,ISO) regulation of lamellipodium morphogenesis (IEA,ISO) regulation of microvillus length (IEA,ISO) regulation of wound healing (IEA,ISO) response to bacterium (IEA,ISO) terminal web assembly (IEA,ISO)
Vil1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 83,440,248 - 83,467,963 (+) NCBI GRCr8 mRatBN7.2 9 75,991,141 - 76,018,860 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 75,991,141 - 76,018,858 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 84,436,168 - 84,463,861 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 89,565,114 - 89,592,807 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 87,951,296 - 87,978,989 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 81,689,802 - 81,717,623 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 81,689,802 - 81,717,621 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 81,454,351 - 81,482,172 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 73,748,632 - 73,776,347 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 73,895,763 - 73,923,376 (+) NCBI Celera 9 73,564,428 - 73,592,138 (+) NCBI Celera Cytogenetic Map 9 q33 NCBI
VIL1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 218,419,123 - 218,453,295 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 218,419,121 - 218,453,295 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 219,283,846 - 219,318,018 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 218,996,722 - 219,022,489 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 219,113,984 - 219,139,746 NCBI Celera 2 213,050,445 - 213,080,856 (+) NCBI Celera Cytogenetic Map 2 q35 NCBI HuRef 2 211,136,728 - 211,167,137 (+) NCBI HuRef CHM1_1 2 219,290,456 - 219,320,861 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 218,905,241 - 218,939,415 (+) NCBI T2T-CHM13v2.0
Vil1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 74,448,543 - 74,474,719 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 74,448,535 - 74,474,718 (+) Ensembl GRCm39 Ensembl GRCm38 1 74,409,384 - 74,435,560 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 74,409,376 - 74,435,559 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 74,455,958 - 74,482,134 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 74,342,613 - 74,368,721 (+) NCBI MGSCv36 mm8 Celera 1 74,966,841 - 74,993,216 (+) NCBI Celera Cytogenetic Map 1 C3 NCBI cM Map 1 38.54 NCBI
Vil1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955453 14,935,456 - 14,961,011 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955453 14,935,450 - 14,961,011 (-) NCBI ChiLan1.0 ChiLan1.0
VIL1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 121,048,369 - 121,080,415 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 121,063,336 - 121,095,726 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 105,677,371 - 105,711,293 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 224,274,548 - 224,304,550 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2B 224,274,548 - 224,304,550 (+) Ensembl panpan1.1 panPan2
VIL1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 37 25,065,887 - 25,090,238 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 37 25,065,180 - 25,090,705 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 37 25,885,686 - 25,911,804 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 37 25,081,617 - 25,107,747 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 37 25,080,855 - 25,106,518 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 37 24,986,923 - 25,013,216 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 37 24,920,579 - 24,946,677 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 37 24,940,950 - 24,966,867 (+) NCBI UU_Cfam_GSD_1.0
Vil1
VIL1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 120,463,566 - 120,492,580 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 120,463,470 - 120,494,772 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 133,479,112 - 133,508,225 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
VIL1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 10 104,311,048 - 104,350,846 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 10 104,320,074 - 104,347,289 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 95,055,245 - 95,084,515 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Vil1
.
Predicted Target Of
Count of predictions: 82 Count of miRNA genes: 66 Interacting mature miRNAs: 68 Transcripts: ENSRNOT00000021432 Prediction methods: Microtar, Miranda Result types: miRGate_prediction
7411571 Bw138 Body weight QTL 138 14.3 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 9 32535505 77535505 Rat 11353957 Bmd92 Bone mineral density QTL 92 0.01 tibia mineral mass (VT:1000283) volumetric bone mineral density (CMO:0001553) 9 46114199 91114199 Rat 61385 Edpm9 Estrogen-dependent pituitary mass QTL 9 3.43 0.05 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 9 63869687 108869687 Rat 70218 Cm28 Cardiac mass QTL 28 8.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 9 25268044 79271759 Rat 724544 Uae9 Urinary albumin excretion QTL 9 4.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 9 25268044 114175309 Rat 1578760 Cm53 Cardiac mass QTL 53 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 9 56771635 101771635 Rat 1581580 Uae34 Urinary albumin excretion QTL 34 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 62072275 96470995 Rat 12879506 Pur33 Proteinuria QTL 33 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 9 44649921 89649921 Rat 1354626 Bvd1 Brain ventricular dilatation QTL 1 3.73 0.001 brain ventricle morphology trait (VT:0000822) hydrocephalus severity score (CMO:0001881) 9 75712843 111552878 Rat 731164 Uae25 Urinary albumin excretion QTL 25 3.5 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 25661188 100929786 Rat 10058949 Gmadr5 Adrenal mass QTL 5 2 0.014 adrenal gland mass (VT:0010420) both adrenal glands wet weight to body weight ratio (CMO:0002411) 9 42791513 87976209 Rat 1578757 Pur6 Proteinuria QTL 6 3.3 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 9 62072275 96470995 Rat 631656 Bp108 Blood pressure QTL 108 5.97 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 48598251 93598251 Rat 2303170 Bp332 Blood pressure QTL 332 3.73 0.027 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 9 55847841 77026453 Rat 8662828 Vetf6 Vascular elastic tissue fragility QTL 6 3.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 9 36962359 92058970 Rat 61352 Bp34 Blood pressure QTL 34 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 42495343 79271511 Rat 724515 Uae16 Urinary albumin excretion QTL 16 8 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 58163035 100929646 Rat 731171 Glom6 Glomerulus QTL 6 2.8 0.0003 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 9 64573531 109573531 Rat 1598834 Memor11 Memory QTL 11 2.5 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 9 36962359 77814038 Rat 70186 Niddm26 Non-insulin dependent diabetes mellitus QTL 26 3.87 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 9 22071169 86369743 Rat 7207814 Bmd91 Bone mineral density QTL 91 3.5 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 9 23754144 83851531 Rat 6903941 Pur31 Proteinuria QTL 31 0.036 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 9 40194188 85194188 Rat 2303180 Bp333 Blood pressure QTL 333 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 56627713 78595166 Rat 2290450 Scl57 Serum cholesterol level QTL 57 4.15 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 9 36962359 95410867 Rat 11353949 Bp393 Blood pressure QTL 393 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 40194188 85194188 Rat 11353951 Bp394 Blood pressure QTL 394 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 44649921 89649921 Rat 10054125 Srcrt7 Stress Responsive Cort QTL 7 3.33 0.0011 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 9 1 87073594 Rat 1300134 Bp185 Blood pressure QTL 185 3.73 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 9 61381434 104821652 Rat 7411656 Foco26 Food consumption QTL 26 9.8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 9 32535505 77535505 Rat
RH129981
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 9 76,018,883 - 76,019,040 (+) MAPPER mRatBN7.2 Rnor_6.0 9 81,717,647 - 81,717,803 NCBI Rnor6.0 Rnor_5.0 9 81,482,196 - 81,482,352 UniSTS Rnor5.0 RGSC_v3.4 9 73,776,371 - 73,776,527 UniSTS RGSC3.4 Celera 9 73,592,162 - 73,592,318 UniSTS RH 3.4 Map 9 709.2 UniSTS Cytogenetic Map 9 q33 UniSTS
RH133743
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 9 76,018,543 - 76,018,761 (+) MAPPER mRatBN7.2 Rnor_6.0 9 81,717,307 - 81,717,524 NCBI Rnor6.0 Rnor_5.0 9 81,481,856 - 81,482,073 UniSTS Rnor5.0 RGSC_v3.4 9 73,776,031 - 73,776,248 UniSTS RGSC3.4 Celera 9 73,591,822 - 73,592,039 UniSTS RH 3.4 Map 9 709.89 UniSTS Cytogenetic Map 9 q33 UniSTS
D9Mco100
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 9 75,990,039 - 75,990,271 (+) MAPPER mRatBN7.2 Rnor_6.0 9 81,688,713 - 81,688,944 NCBI Rnor6.0 Rnor_5.0 9 81,453,262 - 81,453,493 UniSTS Rnor5.0 Celera 9 73,563,319 - 73,563,550 UniSTS Cytogenetic Map 9 q33 UniSTS
GDB:542905
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 9 76,018,119 - 76,018,214 (+) MAPPER mRatBN7.2 mRatBN7.2 4 33,575,924 - 33,576,019 (+) MAPPER mRatBN7.2 Rnor_6.0 4 30,530,901 - 30,530,995 NCBI Rnor6.0 Rnor_6.0 9 81,716,883 - 81,716,977 NCBI Rnor6.0 Rnor_5.0 9 81,481,432 - 81,481,526 UniSTS Rnor5.0 Rnor_5.0 4 30,437,827 - 30,437,921 UniSTS Rnor5.0 RGSC_v3.4 4 30,219,425 - 30,219,519 UniSTS RGSC3.4 RGSC_v3.4 9 73,775,607 - 73,775,701 UniSTS RGSC3.4 Celera 9 73,591,398 - 73,591,492 UniSTS Celera 4 29,102,522 - 29,102,616 UniSTS Cytogenetic Map 4 q13 UniSTS Cytogenetic Map 9 q33 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
5
47
96
90
89
58
22
58
5
202
87
77
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000021432 ⟹ ENSRNOP00000021432
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 75,991,141 - 76,018,858 (+) Ensembl Rnor_6.0 Ensembl 9 81,689,802 - 81,717,621 (+) Ensembl
RefSeq Acc Id:
NM_001108224 ⟹ NP_001101694
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 83,440,248 - 83,467,963 (+) NCBI mRatBN7.2 9 75,991,141 - 76,018,860 (+) NCBI Rnor_6.0 9 81,689,802 - 81,717,623 (+) NCBI Rnor_5.0 9 81,454,351 - 81,482,172 (+) NCBI RGSC_v3.4 9 73,748,632 - 73,776,347 (+) RGD Celera 9 73,564,428 - 73,592,138 (+) RGD
Sequence:
CAGGGACCTGGGCACCTACTTCCCCACCCCCTCATCCATTCTCTCTGGGGCCCTATCTTCCCTTATATGGTGAAGGAAGTTCCTGGGGGTGGGGGGGTGAGGACAAAGGTCGGTCTCCTGCAGCCAGC
hide sequence
RefSeq Acc Id:
NP_001101694 ⟸ NM_001108224
- UniProtKB:
B5DFA0 (UniProtKB/TrEMBL), A6JVU7 (UniProtKB/TrEMBL), F7F8Y1 (UniProtKB/TrEMBL)
- Sequence:
MTKLTAQVKGSLNTTTPGIQIWRIEAMQMVPVPSSTFGSFFDGDCYVVLAIHKTGSTLSYDIHYWIGQDSSQDEQGAAAIYTTQMDDYLKGRAVQHREVQGHESDTFRSYFKQGLVIRKGGVASGMKH
hide sequence
Ensembl Acc Id:
ENSRNOP00000021432 ⟸ ENSRNOT00000021432
RGD ID: 13696753 Promoter ID: EPDNEW_R7277 Type: multiple initiation site Name: Vil1_1 Description: villin 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 9 81,689,935 - 81,689,995 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Vil1
villin 1
Vil1_predicted
villin 1 (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-30
Vil1_predicted
villin 1 (predicted)
Vil_predicted
villin (predicted)
Symbol and Name updated
1299863 APPROVED
2005-01-12
Vil_predicted
villin (predicted)
Symbol and Name status set to approved
70820 APPROVED
