Advanced Search (OLGA)

Gene: Cadm3 (cell adhesion molecule 3) Rattus norvegicus

Analyze

Symbol:

Cadm3

Name:

cell adhesion molecule 3

RGD ID:

1307035

Description:

Predicted to enable protein homodimerization activity. Involved in synaptic membrane adhesion. Is active in GABA-ergic synapse and glutamatergic synapse. Human ortholog(s) of this gene implicated in Charcot-Marie-Tooth disease. Orthologous to human CADM3 (cell adhesion molecule 3); INTERACTS WITH (S)-nicotine; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Igsf4b; immunoglobulin superfamily member 4B; immunoglobulin superfamily, member 4B; LOC360882; Necl-1; nectin-like protein 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CADM3 (cell adhesion molecule 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Cadm3 (cell adhesion molecule 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cadm3 (cell adhesion molecule 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CADM3 (cell adhesion molecule 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CADM3 (cell adhesion molecule 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cadm3 (cell adhesion molecule 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CADM3 (cell adhesion molecule 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CADM3 (cell adhesion molecule 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cadm3 (cell adhesion molecule 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Cadm3 (cell adhesion molecule 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	C1orf116 (chromosome 1 open reading frame 116)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CADM3 (cell adhesion molecule 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cadm3 (cell adhesion molecule 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cadm3 (cell adhesion molecule 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cadm3 (cell adhesion molecule 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	dpr16	Alliance	DIOPT (InParanoid\|SonicParanoid)
Drosophila melanogaster (fruit fly):	dpr19	Alliance	DIOPT (InParanoid\|SonicParanoid)
Drosophila melanogaster (fruit fly):	dpr15	Alliance	DIOPT (InParanoid\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cadm3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cadm3	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Fas3	Alliance	DIOPT (Ensembl Compara\|Hieranoid)
Drosophila melanogaster (fruit fly):	Fas3	Alliance	DIOPT (Ensembl Compara\|Hieranoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	88,317,124 - 88,349,718 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	88,317,124 - 88,350,114 (-)	Ensembl				GRCr8
mRatBN7.2	13	85,784,785 - 85,817,412 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	85,786,483 - 85,817,749 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	88,285,621 - 88,315,367 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	89,685,897 - 89,715,646 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	86,870,625 - 86,900,374 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	13	87,684,902 - 87,717,486 (-)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	13	87,896,021 - 87,928,615 (-)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	13	87,826,568 - 87,859,154 (-)	NCBI		Lyon_Hypertensive
F344_StmMcwi	13	87,885,253 - 87,917,884 (-)	NCBI		F344_StmMcwi
Rnor_6.0	13	91,842,311 - 91,873,126 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	91,842,333 - 91,873,096 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	96,356,679 - 96,388,630 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	89,539,655 - 89,569,914 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	85,391,183 - 85,420,816 (-)	NCBI		Celera
RGSC_v3.1	13	89,727,486 - 89,763,164 (-)	NCBI
Cytogenetic Map	13	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Charcot-Marie-Tooth Disease Axonal Type 2FF (ISO)

genetic disease (ISO)

prostate cancer (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (EXP)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

acetamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

arsane (ISO)

arsenic atom (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

Butylbenzyl phthalate (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

carbon nanotube (ISO)

cobalt dichloride (ISO)

copper(II) chloride (ISO)

dibutyl phthalate (EXP)

diethyl phthalate (EXP)

diisobutyl phthalate (EXP)

diisononyl phthalate (EXP,ISO)

diquat (ISO)

diuron (EXP)

endosulfan (EXP)

ethanol (ISO)

fonofos (ISO)

formaldehyde (ISO)

lead diacetate (ISO)

lead nitrate (ISO)

lead(0) (ISO)

mercury atom (ISO)

mercury(0) (ISO)

mono(2-ethylhexyl) phthalate (ISO)

nicotine (EXP)

okadaic acid (ISO)

ozone (ISO)

parathion (ISO)

pentanal (ISO)

perfluorooctanoic acid (EXP)

potassium chromate (ISO)

sodium arsenite (ISO)

terbufos (ISO)

tetrachloromethane (EXP,ISO)

thimerosal (ISO)

thiram (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell adhesion (IEA)

heterophilic cell-cell adhesion (ISO)

homophilic cell-cell adhesion (IBA,ISO)

intracellular protein localization (ISO)

synaptic membrane adhesion (IDA,IEP,IMP)

Cellular Component

anchoring junction (IEA)

cell-cell junction (ISO)

GABA-ergic synapse (IDA,IEP,IMP)

glutamatergic synapse (IDA,IEP,IMP)

membrane (IEA)

parallel fiber to Purkinje cell synapse (ISO)

plasma membrane (IEA)

presynaptic membrane (IBA,ISO)

synapse (IEA)

Molecular Function

protein binding (ISO)

protein homodimerization activity (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	SynCAMs organize synapses through heterophilic adhesion.	Fogel AI, etal., J Neurosci. 2007 Nov 14;27(46):12516-30.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:12826663	PMID:15741237	PMID:15893517	PMID:16773244	PMID:17724124	PMID:18686604	PMID:21700703	PMID:22871113

Genomics

Comparative Map Data

Cadm3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	88,317,124 - 88,349,718 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	88,317,124 - 88,350,114 (-)	Ensembl				GRCr8
mRatBN7.2	13	85,784,785 - 85,817,412 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	85,786,483 - 85,817,749 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	88,285,621 - 88,315,367 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	89,685,897 - 89,715,646 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	86,870,625 - 86,900,374 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	13	87,684,902 - 87,717,486 (-)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	13	87,896,021 - 87,928,615 (-)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	13	87,826,568 - 87,859,154 (-)	NCBI		Lyon_Hypertensive
F344_StmMcwi	13	87,885,253 - 87,917,884 (-)	NCBI		F344_StmMcwi
Rnor_6.0	13	91,842,311 - 91,873,126 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	91,842,333 - 91,873,096 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	96,356,679 - 96,388,630 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	89,539,655 - 89,569,914 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	85,391,183 - 85,420,816 (-)	NCBI		Celera
RGSC_v3.1	13	89,727,486 - 89,763,164 (-)	NCBI
Cytogenetic Map	13	q24	NCBI

CADM3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	159,171,615 - 159,203,313 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	159,171,609 - 159,203,313 (+)	Ensembl			hg38	GRCh38
GRCh37	1	159,141,405 - 159,173,103 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	157,408,044 - 157,438,426 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	155,954,492 - 155,984,874	NCBI
Celera	1	132,211,622 - 132,243,171 (+)	NCBI		Celera
Cytogenetic Map	1	q23.2	NCBI
HuRef	1	130,498,522 - 130,530,071 (+)	NCBI		HuRef
CHM1_1	1	160,536,806 - 160,568,362 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	158,308,647 - 158,340,339 (+)	NCBI		T2T-CHM13v2.0

Cadm3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	173,161,825 - 173,195,214 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	173,160,825 - 173,195,261 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	1	173,331,892 - 173,368,139 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	173,333,258 - 173,367,695 (-)	Ensembl			mm10	GRCm38
MGSCv37	1	175,264,385 - 175,297,826 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	1	175,170,929 - 175,204,370 (-)	NCBI		MGSCv36	mm8
Celera	1	176,183,311 - 176,218,109 (-)	NCBI		Celera
Cytogenetic Map	1	H3	NCBI
cM Map	1	80.33	NCBI

Cadm3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955468	10,963,724 - 10,994,266 (+)	Ensembl
ChiLan1.0	NW_004955468	10,963,773 - 10,994,266 (+)	NCBI	ChiLan1.0	ChiLan1.0

CADM3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	90,654,051 - 90,683,717 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	90,390,584 - 90,420,952 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	134,522,614 - 134,552,959 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	138,319,952 - 138,351,606 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	138,319,952 - 138,350,307 (+)	Ensembl			panPan2	panpan1.1

CADM3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	38	22,765,479 - 22,782,162 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	38	22,766,698 - 22,797,072 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	38	22,778,427 - 22,809,646 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	38	22,889,144 - 22,921,377 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	38	22,889,169 - 22,921,349 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	38	22,653,815 - 22,685,167 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	38	23,188,986 - 23,220,281 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	38	23,619,494 - 23,650,802 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Cadm3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	5,423,134 - 5,454,101 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936740	1,299,043 - 1,331,453 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936740	1,298,512 - 1,331,376 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CADM3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	91,227,363 - 91,260,097 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	4	91,227,362 - 91,260,125 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	99,224,656 - 99,257,548 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CADM3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	4,746,751 - 4,777,321 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	4,747,800 - 4,777,298 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666038	3,892,257 - 3,923,972 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cadm3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624794	2,125,821 - 2,154,557 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624794	2,125,741 - 2,154,346 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Cadm3
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	10	52,368,479 - 52,399,213 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Cadm3
721 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	199
Count of miRNA genes:	122
Interacting mature miRNAs:	157
Transcripts:	ENSRNOT00000004613
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	21120177	109350286	Rat
738027	Lnnr6	Liver neoplastic nodule remodeling QTL 6	3.3		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	65613454	109350286	Rat
7387280	Uae43	Urinary albumin excretion QTL 43	5.69	0.4174	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	68983334	109350286	Rat
1298066	Bp159	Blood pressure QTL 159		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	48639634	93639634	Rat
10755495	Bp387	Blood pressure QTL 387	3.78		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	37216241	90057603	Rat
2293702	Bss34	Bone structure and strength QTL 34	4.61	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	13	67635937	109350286	Rat
1576318	Schws5	Schwannoma susceptibility QTL 5		0.0351	nervous system integrity trait (VT:0010566)	post-insult time to trigeminal nerve neurilemmoma formation (CMO:0002019)	13	64497900	109350286	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	11081740	103588154	Rat
1581554	Pur11	Proteinuria QTL 11			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	38975045	103588154	Rat
8655951	Rf63	Renal function QTL 63	12.2		blood urea nitrogen amount (VT:0005265)	plasma urea nitrogen level (CMO:0000586)	13	71610804	109350286	Rat
4889606	Gluco63	Glucose level QTL 63	2.86	0.003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	83286150	109350286	Rat
8655945	Rf61	Renal function QTL 61	3.6		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	13	71610804	89333251	Rat
1331783	Bp221	Blood pressure QTL 221	3.72886		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	71610804	89333251	Rat
8655959	Pur32	Proteinuria QTL 32	8.4		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	72984506	99745408	Rat
2293687	Bss26	Bone structure and strength QTL 26	4.6	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	13	67635937	109350286	Rat
1300166	Kidm6	Kidney mass QTL 6	3.93		kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	13	71610804	89333251	Rat
12879475	Bp400	Blood pressure QTL 400			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	64375743	109350286	Rat
1581573	Uae36	Urinary albumin excretion QTL 36			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	103588154	Rat
724564	Uae11	Urinary albumin excretion QTL 11	5.7		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	13	47354258	94285672	Rat
2293341	Glom15	Glomerulus QTL 15	9.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	13	67635937	109350286	Rat

Markers in Region

RH133255

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	85,786,699 - 85,786,885 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	91,842,550 - 91,842,735	NCBI	Rnor6.0
Rnor_5.0	13	96,356,918 - 96,357,103	UniSTS	Rnor5.0
RGSC_v3.4	13	89,538,842 - 89,539,027	UniSTS	RGSC3.4
Celera	13	85,390,370 - 85,390,555	UniSTS
RH 3.4 Map	13	563.9	UniSTS
Cytogenetic Map	13	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	163	91	90	59	79	59	6	335	179	11	142	73	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001047103	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001412817	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC161811	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473985	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ272743	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000004613 ⟹ ENSRNOP00000004613

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	88,317,124 - 88,329,884 (-)	Ensembl
mRatBN7.2 Ensembl	13	85,786,483 - 85,797,548 (-)	Ensembl
Rnor_6.0 Ensembl	13	91,842,333 - 91,872,954 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000079263 ⟹ ENSRNOP00000074496

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	88,317,124 - 88,350,114 (-)	Ensembl
mRatBN7.2 Ensembl	13	85,786,483 - 85,817,749 (-)	Ensembl
Rnor_6.0 Ensembl	13	91,843,186 - 91,873,096 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097938 ⟹ ENSRNOP00000083207

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	88,317,124 - 88,350,114 (-)	Ensembl
mRatBN7.2 Ensembl	13	85,786,483 - 85,817,749 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000099664 ⟹ ENSRNOP00000091652

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	88,317,124 - 88,332,285 (-)	Ensembl
mRatBN7.2 Ensembl	13	85,786,483 - 85,799,951 (-)	Ensembl

RefSeq Acc Id:

NM_001047103 ⟹ NP_001040568

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	88,317,124 - 88,349,718 (-)	NCBI
mRatBN7.2	13	85,784,785 - 85,817,389 (-)	NCBI
Dahl_SR_JrHsd	13	87,684,902 - 87,717,486 (-)	NCBI
Lyon_Normotensive	13	87,896,021 - 87,928,615 (-)	NCBI
Lyon_Hypertensive	13	87,826,568 - 87,859,154 (-)	NCBI
F344_StmMcwi	13	87,885,253 - 87,917,884 (-)	NCBI
Rnor_6.0	13	91,843,363 - 91,872,953 (-)	NCBI
Rnor_5.0	13	96,356,679 - 96,388,630 (-)	NCBI
RGSC_v3.4	13	89,539,655 - 89,569,914 (-)	RGD
Celera	13	85,391,183 - 85,420,816 (-)	RGD

Sequence:

show sequence

ATGGGGGCCCCTTCCGCCCTGCCCCTGCTCCTGCTCCTCGCCTGCTCCTGGGCGCCCGGCGGGG
CCAATCTTTCCCAGGACGATAGCCAGCCCTGGACGTCTGATGAAACAGTGGTGGCTGGTGGCAC
AGTAGTGCTCAAGTGCCAAGTGAAAGACCATGAAGACTCATCTCTGCAGTGGTCTAACCCTGCC
CAGCAGACTCTATACTTTGGGGAGAAAAGAGCCCTTCGAGATAATCGGATTCAGCTGGTTAGCT
CCACCCCGCATGAGCTCAGCATCAGCATCAGCAACGTGGCACTGGCCGACGAGGGCGAGTACAC
ATGCTCCATCTTCACTATGCCTGTGCGGACCGCCAAGTCCCTCGTCACTGTGCTCGGAATCCCA
CAGAAACCCATAATCACTGGTTATAAGTCATCGTTGCGGGAAAAGGAGACAGCCACTCTAAATT
GTCAGTCTTCTGGGAGCAAACCTGCAGCCCAGCTCGCCTGGAGAAAAGGTGACCAAGAACTCCA
CGGGGACCAGACGCGAATCCAGGAAGATCCCAATGGGAAAACCTTCACTGTGAGCAGCTCGGTG
TCATTCCAGGTTACCCGGGATGATGATGGAGCAAACGTCGTGTGCTCTGTGAACCATGAATCTC
TGAAGGGAGCTGACAGATCCACCTCTCAGCGCATTGAAGTGTTATACACACCAACAGCCATGAT
TAGGCCAGAACCTGCTCATCCTCGTGAAGGCCAGAAGCTGTTGTTACATTGTGAGGGGCGTGGC
AATCCAGTCCCTCAGCAGTACGTGTGGGTAAAAGAAGGCAGCGAGCCACCCCTCAAGATGACCC
AAGAGAGTGCACTCATCTTCCCATTTTTGAACAAAAGTGACAGTGGCACCTATGGCTGTACAGC
CACGAGCAACATGGGCAGCTATACAGCCTACTTCACTCTCAATGTCAACGACCCTAGTCCAGTG
CCCTCATCCTCCAGTACTTACCACGCCATCATTGGAGGGATCGTGGCTTTCATCGTCTTCCTGC
TGCTCATTCTGCTCATTTTCCTTGGACACTATTTGATCCGGCACAAAGGAACGTACCTGACACA
CGAAGCGAAGGGCTCCGACGACGCCCCAGATGCAGATACGGCCATCATCAACGCAGAAGGCGGG
CAGTCAGGCGGGGATGACAAGAAGGAATATTTCATCTAG

hide sequence

RefSeq Acc Id:

NM_001412817 ⟹ NP_001399746

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	88,317,124 - 88,349,718 (-)	NCBI
mRatBN7.2	13	85,784,785 - 85,817,389 (-)	NCBI
Dahl_SR_JrHsd	13	87,684,902 - 87,717,486 (-)	NCBI
Lyon_Normotensive	13	87,896,021 - 87,928,615 (-)	NCBI
Lyon_Hypertensive	13	87,826,568 - 87,859,154 (-)	NCBI
F344_StmMcwi	13	87,885,253 - 87,917,884 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001040568	(Get FASTA)	NCBI Sequence Viewer
	NP_001399746	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI61811	(Get FASTA)	NCBI Sequence Viewer
	ABB85362	(Get FASTA)	NCBI Sequence Viewer
	EDL94742	(Get FASTA)	NCBI Sequence Viewer
	EDL94743	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000004613
	ENSRNOP00000091652
GenBank Protein	Q1WIM3	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001040568 ⟸ NM_001047103
- Peptide Label:	isoform 2 precursor
- UniProtKB:	Q1WIM3 (UniProtKB/Swiss-Prot), A0A8L2UHK9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGAPSALPLLLLLACSWAPGGANLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPA QQTLYFGEKRALRDNRIQLVSSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIP QKPIITGYKSSLREKETATLNCQSSGSKPAAQLAWRKGDQELHGDQTRIQEDPNGKTFTVSSSV SFQVTRDDDGANVVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPEPAHPREGQKLLLHCEGRG NPVPQQYVWVKEGSEPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYTAYFTLNVNDPSPV PSSSSTYHAIIGGIVAFIVFLLLILLIFLGHYLIRHKGTYLTHEAKGSDDAPDADTAIINAEGG QSGGDDKKEYFI hide sequence

Ensembl Acc Id:

ENSRNOP00000074496 ⟸ ENSRNOT00000079263

Ensembl Acc Id:

ENSRNOP00000004613 ⟸ ENSRNOT00000004613

Ensembl Acc Id:

ENSRNOP00000083207 ⟸ ENSRNOT00000097938

Ensembl Acc Id:

ENSRNOP00000091652 ⟸ ENSRNOT00000099664

RefSeq Acc Id:	NP_001399746 ⟸ NM_001412817
- Peptide Label:	isoform 1 precursor
- UniProtKB:	A0A8I6ACH5 (UniProtKB/TrEMBL)

Protein Domains

Ig-like Ig-like C2-type Ig-like V-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q1WIM3-F1-model_v2	AlphaFold	Q1WIM3	1-396	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699043

Promoter ID:

EPDNEW_R9562

Type:

multiple initiation site

Name:

Cadm3_1

Description:

cell adhesion molecule 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	13	91,873,107 - 91,873,167	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307035	AgrOrtholog
BioCyc Gene	G2FUF-17276	BioCyc
Ensembl Genes	ENSRNOG00000003365	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000004613	ENTREZGENE
	ENSRNOT00000099664	ENTREZGENE
Gene3D-CATH	2.60.40.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7317639	IMAGE-MGC_LOAD
InterPro	CD80_C2-set	UniProtKB/Swiss-Prot
	Ig-like_dom	UniProtKB/Swiss-Prot
	Ig-like_dom_sf	UniProtKB/Swiss-Prot
	Ig-like_fold	UniProtKB/Swiss-Prot
	Ig_sub	UniProtKB/Swiss-Prot
	Ig_sub2	UniProtKB/Swiss-Prot
	Ig_V-set	UniProtKB/Swiss-Prot
	Neurexin-like	UniProtKB/Swiss-Prot
KEGG Report	rno:360882	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:187244	IMAGE-MGC_LOAD
NCBI Gene	360882	ENTREZGENE
PANTHER	CELL ADHESION MOLECULE 3	UniProtKB/Swiss-Prot
	IG-LIKE DOMAIN-CONTAINING PROTEIN	UniProtKB/Swiss-Prot
Pfam	C2-set_2	UniProtKB/Swiss-Prot
	Ig_3	UniProtKB/Swiss-Prot
	V-set	UniProtKB/Swiss-Prot
PhenoGen	Cadm3	PhenoGen
PROSITE	IG_LIKE	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000003365	RatGTEx
SMART	4.1m	UniProtKB/Swiss-Prot
	IGc2	UniProtKB/Swiss-Prot
	SM00409	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF48726	UniProtKB/Swiss-Prot
UniProt	A0A0G2K872_RAT	UniProtKB/TrEMBL
	A0A8I5ZWI1_RAT	UniProtKB/TrEMBL
	A0A8I6ACH5	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2UHK9	ENTREZGENE, UniProtKB/TrEMBL
	CADM3_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-04	Cadm3	cell adhesion molecule 3	Igsf4b_predicted	immunoglobulin superfamily, member 4B (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-12	Igsf4b_predicted	immunoglobulin superfamily, member 4B (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM