Advanced Search (OLGA)

Gene: Zfp580 (zinc finger protein 580) Rattus norvegicus

Analyze

Symbol:

Zfp580

Name:

zinc finger protein 580

RGD ID:

1306892

Description:

Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in several processes, including cellular response to hydrogen peroxide; positive regulation of cell migration; and regulation of gene expression. Predicted to be active in nucleus. Orthologous to human ZNF580 (zinc finger protein 580); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; alpha-Zearalanol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC308336; Znf580

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ZNF580 (zinc finger protein 580)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, OMA, OrthoMCL, PhylomeDB, Treefam
Mus musculus (house mouse):	Zfp580 (zinc finger protein 580)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Znf580 (zinc finger protein 580)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ZNF580 (zinc finger protein 580)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ZNF580 (zinc finger protein 580)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Znf580 (zinc finger protein 580)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	LOC100627967 (zinc finger protein 580)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ZNF580 (zinc finger protein 580)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Znf580 (zinc finger protein 580)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ZNF580 (zinc finger protein 580)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ZNF580 (zinc finger protein 580)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Zfp580 (zinc finger protein 580)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Zfp580 (zinc finger protein 580)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	77,815,959 - 77,818,127 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	77,815,461 - 77,834,295 (-)	Ensembl				GRCr8
mRatBN7.2	1	68,787,118 - 68,789,286 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	68,787,118 - 68,789,286 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	74,132,199 - 74,134,367 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	82,696,505 - 82,698,673 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	75,845,181 - 75,847,349 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	72,338,468 - 72,340,636 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	72,338,877 - 72,339,395 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	76,195,265 - 76,197,609 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	67,525,765 - 67,527,928 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	68,329,929 - 68,332,097 (+)	NCBI		Celera
RGSC_v3.1	1	67,604,037 - 67,606,082 (-)	NCBI
Cytogenetic Map	1	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

alpha-Zearalanol (EXP)

amitrole (EXP)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

bortezomib (ISO)

butanal (ISO)

chlorpyrifos (ISO)

cobalt dichloride (ISO)

DDE (ISO)

dexamethasone (ISO)

diallyl trisulfide (ISO)

dibutyl phthalate (EXP)

doxorubicin (ISO)

elemental selenium (ISO)

gentamycin (EXP)

hydrogen peroxide (ISO)

indometacin (ISO)

maneb (ISO)

methimazole (EXP)

methotrexate (ISO)

okadaic acid (ISO)

paracetamol (ISO)

paraquat (ISO)

perfluorooctanoic acid (EXP)

pyridaben (ISO)

quercetin (ISO)

resveratrol (ISO)

selenium atom (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

trovafloxacin (ISO)

valproic acid (ISO)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to hydrogen peroxide (IEA,ISO)

chemotaxis (IEA)

DNA-templated transcription (IEA)

inflammatory response (IEA)

positive regulation of endothelial cell migration (IEA,ISO)

positive regulation of endothelial cell proliferation (IEA,ISO)

positive regulation of gene expression (IEA,ISO)

positive regulation of interleukin-8 production (IEA,ISO)

positive regulation of leukocyte chemotaxis (IEA,ISO)

positive regulation of transcription by RNA polymerase II (IEA)

regulation of transcription by RNA polymerase II (IBA)

Cellular Component

nucleus (IBA,IEA,ISO)

Molecular Function

DNA binding (IEA)

DNA-binding transcription activator activity, RNA polymerase II-specific (IBA)

metal ion binding (IEA)

protein binding (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA)

sequence-specific double-stranded DNA binding (IEA,ISO)

zinc ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:20382120	PMID:21599657	PMID:21830064	PMID:24722354	PMID:26268592	PMID:30423583	PMID:34929337

Genomics

Comparative Map Data

Zfp580
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	77,815,959 - 77,818,127 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	77,815,461 - 77,834,295 (-)	Ensembl				GRCr8
mRatBN7.2	1	68,787,118 - 68,789,286 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	68,787,118 - 68,789,286 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	74,132,199 - 74,134,367 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	82,696,505 - 82,698,673 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	75,845,181 - 75,847,349 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	72,338,468 - 72,340,636 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	72,338,877 - 72,339,395 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	76,195,265 - 76,197,609 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	67,525,765 - 67,527,928 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	68,329,929 - 68,332,097 (+)	NCBI		Celera
RGSC_v3.1	1	67,604,037 - 67,606,082 (-)	NCBI
Cytogenetic Map	1	q12	NCBI

ZNF580
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	55,641,002 - 55,643,470 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	55,635,003 - 55,643,470 (+)	Ensembl			hg38	GRCh38
GRCh37	19	56,152,368 - 56,154,836 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	60,844,204 - 60,846,648 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	19	53,194,671 - 53,197,112 (+)	NCBI		Celera
Cytogenetic Map	19	q13.42	NCBI
HuRef	19	52,462,864 - 52,465,305 (+)	NCBI		HuRef
HuRef	19	52,456,832 - 52,462,631 (+)	NCBI		HuRef
CHM1_1	19	56,140,008 - 56,145,806 (+)	NCBI		CHM1_1
CHM1_1	19	56,146,039 - 56,148,480 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	58,736,919 - 58,739,384 (+)	NCBI		T2T-CHM13v2.0

Zfp580
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	5,041,682 - 5,056,722 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	5,054,537 - 5,056,722 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm39 Ensembl	7	5,041,273 - 5,051,554 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	5,038,519 - 5,053,723 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	5,051,538 - 5,053,723 (+)	Ensembl			mm10	GRCm38
MGSCv37	7	5,003,134 - 5,005,325 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	4,655,076 - 4,656,810 (+)	NCBI		MGSCv36	mm8
Celera	7	4,793,610 - 4,795,801 (+)	NCBI		Celera
Cytogenetic Map	7	A1	NCBI
cM Map	7	2.92	NCBI

Znf580
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955567	705,744 - 708,369 (-)	Ensembl
ChiLan1.0	NW_004955567	706,061 - 707,995 (-)	NCBI	ChiLan1.0	ChiLan1.0

ZNF580
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	61,782,604 - 61,785,194 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	63,513,582 - 63,517,186 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	52,688,477 - 52,690,648 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	61,373,643 - 61,375,823 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2

ZNF580
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	102,099,958 - 102,104,062 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	102,100,308 - 102,100,823 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	102,157,043 - 102,169,195 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	102,753,454 - 102,765,598 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	102,753,804 - 102,754,319 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	102,391,019 - 102,403,158 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	102,102,871 - 102,115,009 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	102,865,974 - 102,878,375 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Znf580
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	1,729,817 - 1,731,430 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936981	166,849 - 167,367 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936981	166,736 - 167,806 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LOC100627967
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	59,761,947 - 59,764,373 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	59,759,447 - 59,764,376 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	54,580,228 - 54,583,976 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ZNF580
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	48,232,119 - 48,234,249 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	48,230,934 - 48,233,858 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666045	888,995 - 893,489 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Znf580
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624832	1,769,405 - 1,771,655 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624832	1,769,405 - 1,771,224 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Zfp580
13 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	100
Count of miRNA genes:	82
Interacting mature miRNAs:	87
Transcripts:	ENSRNOT00000021772
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331732	Srn4	Serum renin concentration QTL 4	4.467		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	1	43457837	87558729	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	51940904	101229020	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	39728272	132889942	Rat
4889929	Bss87	Bone structure and strength QTL 87	6.7		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	46302615	91302615	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
1331792	Rf29	Renal function QTL 29	4.589		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	1	43457837	87558729	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	46302615	91302615	Rat
8552900	Pigfal1	Plasma insulin-like growth factor 1 level QTL 1	7.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	43509952	88509952	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	51940904	168768703	Rat
1354643	Foco2	Food consumption QTL 2	7.17	0.0001	eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	1	42122968	87122968	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	66404680	111404680	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	46302615	91302615	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	66009857	160501508	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
1331778	Rf28	Renal function QTL 28	4.66		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	1	43457837	87558729	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	46302615	91302615	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	66400974	132889942	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	51511344	153680016	Rat
1331785	Rf27	Renal function QTL 27	4.643		urine sodium amount (VT:0006274)	urine sodium level (CMO:0000129)	1	30708375	87558729	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	65405637	96805205	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	34565726	79565726	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	51909206	91302615	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	58769992	103769992	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	46302615	91302615	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	66077886	111077886	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
9589820	Insglur3	Insulin/glucose ratio QTL 3	10.75	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	1	43509952	88509952	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	52891222	109116986	Rat
1354599	Bw29	Body weight QTL 29	3.46	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	42122968	87122968	Rat
4889919	Bss86	Bone structure and strength QTL 86	4.1		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	1	46302615	91302615	Rat
8552948	Pigfal11	Plasma insulin-like growth factor 1 level QTL 11	4.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	43509952	88509952	Rat

Markers in Region

RH133950

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	68,787,152 - 68,787,365 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	72,338,503 - 72,338,715	NCBI	Rnor6.0
Rnor_5.0	1	76,197,362 - 76,197,574	UniSTS	Rnor5.0
RGSC_v3.4	1	67,525,801 - 67,526,013	UniSTS	RGSC3.4
Celera	1	68,331,850 - 68,332,062	UniSTS
Cytogenetic Map	1	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	163	90	89	58	92	58	6	355	192	11	142	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001317059	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CB807411	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474075	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000021772 ⟹ ENSRNOP00000021772

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	77,816,368 - 77,817,691 (-)	Ensembl
mRatBN7.2 Ensembl	1	68,787,527 - 68,788,850 (-)	Ensembl
Rnor_6.0 Ensembl	1	72,338,877 - 72,339,395 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000110039 ⟹ ENSRNOP00000090245

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	77,815,768 - 77,834,281 (-)	Ensembl
mRatBN7.2 Ensembl	1	68,787,118 - 68,789,286 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000127525 ⟹ ENSRNOP00000105127

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	77,815,583 - 77,834,295 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000149691 ⟹ ENSRNOP00000110675

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	77,815,461 - 77,823,830 (-)	Ensembl

RefSeq Acc Id:

NM_001317059 ⟹ NP_001303988

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	77,815,959 - 77,818,127 (-)	NCBI
mRatBN7.2	1	68,787,118 - 68,789,286 (-)	NCBI
Rnor_6.0	1	72,338,468 - 72,340,636 (-)	NCBI
Celera	1	68,329,929 - 68,332,097 (+)	NCBI

Sequence:

show sequence

GTCGCCCCTCGCGCCCCTGCGCCCCCCGACCCGCGTCCCCGGCGCCGCCGGCCCGGAGCTGCCC
GGAAGCTCGCTCCTACCGCGGCGCTCGTCAGGGCAAGCCCGGGTCCGTCCGGGACCTCGGCCCC
GTTCTCCCCCGGACCCGAGAGGCTGCTGCACCGGCTGCCGCTCCAGATGCTGCTGCTGCCGCCG
CGGCCACCCCACCCTCGGTCCTCCTCTCCGGAGGTCATGGACCCACCGCCCCCCAAGACTCCCC
CTTTTCCCAAGGCGGAAGGCCCCTCCTCCACTTCTTCCTCGGTGGCGGGGCCGCGGCCACCGCG
GCTGGGCCGCCATCTGCTCATCGACGCCAACGGGGTCCCCTACACGTACACGGTGCAGCTGGAG
GAGGAACCTAGGGGCCCGCCGCAGCGCGAGGCGACCCCGGGAGAGCCAGGTCCTCGCAAGGGCT
ACAGCTGCCCAGAGTGCGCTCGTGTCTTTGCCAGCCCTCTGCGGCTGCAGAGCCACCGTGTGTC
GCACTCGGACCTCAAGCCCTTTACTTGTGGTGCTTGTGGCAAAGCTTTCAAGCGCTCCAGCCAC
CTGTCGCGGCACCGCGCCACCCACCGTGCGCGCGCTGGTCCACCTCACACCTGCCCACTCTGTC
CACGCCGCTTCCAGGACGCCGCGGAGCTGGCGCAACACGTGCGCCTGCACTAAGTTCAGCCCTG
CTCTCTCTGGGCCACCACGTTCGTCCCACACAGTGTCATTCCTACACATATCCCAGTTCTGCTG
AGGTTACTGCCTTACCCTAGGCCTCAGTTTCCCCACCAACCCCCAAAGAGAAACATCATTTCGT
CTTTTCTTCTGTCTAGCTGTGTGATGTAGACCAAAGTTGTTGCCCCTCTGGGCCTGGGTGTCAA
TTGGAACTGGGCTTCAGTCCAGCCGTGCTGTGTAAGCCTTTGCAAATGCTACGACCTCTCCTGA
GTCTTGGTCGTCTACTCTTCCCAAGTAGTAAGGTCCTCGTGGAAGAAATGACAAAAGCACCAGC
ACGGTCTGGATCACCTCTGTACTTCCCTCTAATGCCCATGATCCCTCGTTCTTTGCCCAATAAA
CATTCCGCACTTCA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001303988	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL75884	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000021772.5
	ENSRNOP00000090245
	ENSRNOP00000090245.1
	ENSRNOP00000105127.1
	ENSRNOP00000110675.1

RefSeq Acc Id:	NP_001303988 ⟸ NM_001317059
- UniProtKB:	A0A8I6A911 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLLLPPRPPHPRSSSPEVMDPPPPKTPPFPKAEGPSSTSSSVAGPRPPRLGRHLLIDANGVPYT YTVQLEEEPRGPPQREATPGEPGPRKGYSCPECARVFASPLRLQSHRVSHSDLKPFTCGACGKA FKRSSHLSRHRATHRARAGPPHTCPLCPRRFQDAAELAQHVRLH hide sequence

Ensembl Acc Id:

ENSRNOP00000021772 ⟸ ENSRNOT00000021772

Ensembl Acc Id:

ENSRNOP00000090245 ⟸ ENSRNOT00000110039

Ensembl Acc Id:

ENSRNOP00000110675 ⟸ ENSRNOT00000149691

Ensembl Acc Id:

ENSRNOP00000105127 ⟸ ENSRNOT00000127525

Protein Domains

C2H2-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A235-F1-model_v2	AlphaFold	D4A235	1-172	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306892	AgrOrtholog
BioCyc Gene	G2FUF-60881	BioCyc
Ensembl Genes	ENSRNOG00000016274	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000021772.7	UniProtKB/TrEMBL
	ENSRNOT00000110039	ENTREZGENE
	ENSRNOT00000110039.2	UniProtKB/TrEMBL
	ENSRNOT00000127525.1	UniProtKB/TrEMBL
	ENSRNOT00000149691.1	UniProtKB/TrEMBL
Gene3D-CATH	Classic Zinc Finger	UniProtKB/TrEMBL
InterPro	Znf_C2H2/integrase_DNA-bd	UniProtKB/TrEMBL
	Znf_C2H2_sf	UniProtKB/TrEMBL
KEGG Report	rno:308336	UniProtKB/TrEMBL
NCBI Gene	308336	ENTREZGENE
PANTHER	KRUEPPEL-LIKE TRANSCRIPTION FACTOR	UniProtKB/TrEMBL
	KRUPPEL-LIKE FACTOR 15	UniProtKB/TrEMBL
Pfam	zf-C2H2	UniProtKB/TrEMBL
PhenoGen	Zfp580	PhenoGen
PROSITE	ZINC_FINGER_C2H2_1	UniProtKB/TrEMBL
	ZINC_FINGER_C2H2_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000016274	RatGTEx
SMART	ZnF_C2H2	UniProtKB/TrEMBL
Superfamily-SCOP	SSF57667	UniProtKB/TrEMBL
UniProt	A0A8I6A911	ENTREZGENE, UniProtKB/TrEMBL
	D4A235_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-07-19	Zfp580	zinc finger protein 580	Znf580	zinc finger protein 580	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-25	Znf580	zinc finger protein 580	Zfp580	zinc finger protein 580	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Zfp580	zinc finger protein 580	Zfp580_predicted	zinc finger protein 580 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Zfp580_predicted	zinc finger protein 580 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message