Symbol:
Mrpl1
Name:
mitochondrial ribosomal protein L1
RGD ID:
1306850
Description:
Predicted to enable RNA binding activity. Predicted to be a structural constituent of ribosome. Predicted to be involved in translation. Predicted to be located in mitochondrion and ribosome. Predicted to be part of large ribosomal subunit. Orthologous to human MRPL1 (mitochondrial ribosomal protein L1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrotoluene; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
39S ribosomal protein L1, mitochondrial; large ribosomal subunit protein uL1m; LOC100359687; LOC289491; mitochondrial ribosomal protein L1-like
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 13,604,498 - 13,663,633 (-) NCBI GRCr8 mRatBN7.2 14 13,300,522 - 13,359,654 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 13,300,522 - 13,359,721 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 13,267,793 - 13,327,734 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 14,567,648 - 14,627,589 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 13,284,132 - 13,344,073 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 14,951,507 - 15,008,136 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 14,951,495 - 15,008,150 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 14,893,399 - 14,944,235 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 14,813,544 - 14,872,680 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 14,813,544 - 14,873,482 (-) NCBI Celera 14 13,347,923 - 13,406,905 (-) NCBI Celera Cytogenetic Map 14 p22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mrpl1 Rat 1,2-dimethylhydrazine decreases expression ISO Mrpl1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of MRPL1 mRNA CTD PMID:22206623 Mrpl1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Mrpl1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of MRPL1 mRNA CTD PMID:19770486 Mrpl1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of MRPL1 mRNA CTD PMID:33387578 Mrpl1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MRPL1 mRNA CTD PMID:32109520 Mrpl1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Mrpl1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MRPL1 mRNA CTD PMID:21570461 Mrpl1 Rat 2,4,6-trinitrotoluene affects expression EXP 6480464 Trinitrotoluene affects the expression of MRPL1 mRNA CTD PMID:21346803 Mrpl1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of MRPL1 mRNA CTD PMID:21346803 Mrpl1 Rat 2-hydroxypropanoic acid decreases expression ISO MRPL1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of MRPL1 mRNA CTD PMID:30851411 Mrpl1 Rat 2-methylcholine affects expression ISO MRPL1 (Homo sapiens) 6480464 beta-methylcholine affects the expression of MRPL1 mRNA CTD PMID:21179406 Mrpl1 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Mrpl1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of MRPL1 mRNA CTD PMID:18648102 Mrpl1 Rat 4,4'-sulfonyldiphenol increases expression ISO Mrpl1 (Mus musculus) 6480464 bisphenol S results in increased expression of MRPL1 mRNA CTD PMID:39298647 Mrpl1 Rat aflatoxin M1 decreases expression ISO MRPL1 (Homo sapiens) 6480464 Aflatoxin M1 results in decreased expression of MRPL1 mRNA CTD PMID:30928695 Mrpl1 Rat arsenite(3-) multiple interactions ISO MRPL1 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to MRPL1 mRNA] CTD PMID:32406909 Mrpl1 Rat atrazine decreases expression ISO MRPL1 (Homo sapiens) 6480464 Atrazine results in decreased expression of MRPL1 mRNA CTD PMID:22378314 Mrpl1 Rat benzo[a]pyrene decreases expression ISO Mrpl1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of MRPL1 mRNA CTD PMID:20504355 Mrpl1 Rat benzo[a]pyrene decreases methylation ISO MRPL1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of MRPL1 promoter CTD PMID:27901495 Mrpl1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO MRPL1 (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Mrpl1 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Mrpl1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of MRPL1 mRNA CTD PMID:39150890 Mrpl1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MRPL1 mRNA CTD PMID:25181051 Mrpl1 Rat bisphenol A decreases expression ISO MRPL1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of MRPL1 protein CTD PMID:34186270 Mrpl1 Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of MRPL1 mRNA CTD PMID:24136188 Mrpl1 Rat Butylbenzyl phthalate multiple interactions ISO Mrpl1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of MRPL1 mRNA CTD PMID:39150890 Mrpl1 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of MRPL1 mRNA CTD PMID:19167457 Mrpl1 Rat cadmium atom decreases expression ISO Mrpl1 (Mus musculus) 6480464 Cadmium results in decreased expression of MRPL1 mRNA CTD PMID:24067728 Mrpl1 Rat cadmium dichloride affects methylation EXP 6480464 Cadmium Chloride affects the methylation of MRPL1 promoter CTD PMID:22457795 Mrpl1 Rat CGP 52608 multiple interactions ISO MRPL1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to MRPL1 gene] CTD PMID:28238834 Mrpl1 Rat chlorpyrifos decreases expression ISO Mrpl1 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of MRPL1 mRNA CTD PMID:37019170 Mrpl1 Rat copper(II) sulfate decreases expression ISO MRPL1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of MRPL1 mRNA CTD PMID:19549813 Mrpl1 Rat curcumin increases expression ISO MRPL1 (Homo sapiens) 6480464 Curcumin results in increased expression of MRPL1 mRNA CTD PMID:17198877 Mrpl1 Rat cylindrospermopsin increases expression ISO MRPL1 (Homo sapiens) 6480464 cylindrospermopsin results in increased expression of MRPL1 mRNA CTD PMID:24921660 Mrpl1 Rat dibutyl phthalate multiple interactions ISO Mrpl1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of MRPL1 mRNA CTD PMID:39150890 Mrpl1 Rat dicrotophos decreases expression ISO MRPL1 (Homo sapiens) 6480464 dicrotophos results in decreased expression of MRPL1 mRNA CTD PMID:28302478 Mrpl1 Rat diethyl phthalate multiple interactions ISO Mrpl1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of MRPL1 mRNA CTD PMID:39150890 Mrpl1 Rat diisobutyl phthalate multiple interactions ISO Mrpl1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of MRPL1 mRNA CTD PMID:39150890 Mrpl1 Rat diisononyl phthalate multiple interactions ISO Mrpl1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of MRPL1 mRNA CTD PMID:39150890 Mrpl1 Rat diquat increases expression ISO Mrpl1 (Mus musculus) 6480464 Diquat results in increased expression of MRPL1 protein CTD PMID:36851058 Mrpl1 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of MRPL1 mRNA CTD PMID:24136188 Mrpl1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of MRPL1 mRNA CTD PMID:24136188 Mrpl1 Rat formaldehyde decreases expression ISO MRPL1 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of MRPL1 mRNA CTD PMID:23649840 Mrpl1 Rat FR900359 increases phosphorylation ISO MRPL1 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of MRPL1 protein CTD PMID:37730182 Mrpl1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of MRPL1 mRNA CTD PMID:22061828 Mrpl1 Rat hydrogen peroxide affects expression ISO MRPL1 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of MRPL1 mRNA CTD PMID:20044591 Mrpl1 Rat ivermectin decreases expression ISO MRPL1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of MRPL1 protein CTD PMID:32959892 Mrpl1 Rat methylmercury chloride decreases expression ISO MRPL1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of MRPL1 mRNA CTD PMID:28001369 Mrpl1 Rat nickel sulfate decreases expression ISO MRPL1 (Homo sapiens) 6480464 nickel sulfate results in decreased expression of MRPL1 mRNA CTD PMID:22714537 Mrpl1 Rat paracetamol affects expression ISO Mrpl1 (Mus musculus) 6480464 Acetaminophen affects the expression of MRPL1 mRNA CTD PMID:17562736 Mrpl1 Rat paracetamol decreases expression ISO MRPL1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of MRPL1 mRNA CTD PMID:25704631 and PMID:29067470 Mrpl1 Rat perfluorooctanoic acid increases expression ISO MRPL1 (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of MRPL1 protein CTD PMID:26879310 Mrpl1 Rat pinostrobin increases phosphorylation ISO MRPL1 (Homo sapiens) 6480464 pinostrobin results in increased phosphorylation of MRPL1 protein CTD PMID:37164308 Mrpl1 Rat pirinixic acid decreases expression ISO Mrpl1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of MRPL1 mRNA CTD PMID:18445702 Mrpl1 Rat rac-lactic acid decreases expression ISO MRPL1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of MRPL1 mRNA CTD PMID:30851411 Mrpl1 Rat silicon dioxide increases expression ISO MRPL1 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of MRPL1 mRNA CTD PMID:25895662 Mrpl1 Rat sodium arsenate increases expression ISO Mrpl1 (Mus musculus) 6480464 sodium arsenate results in increased expression of MRPL1 mRNA CTD PMID:21795629 Mrpl1 Rat sodium arsenite decreases expression ISO Mrpl1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of MRPL1 mRNA CTD PMID:36209798 Mrpl1 Rat sulindac decreases expression EXP 6480464 Sulindac results in decreased expression of MRPL1 mRNA CTD PMID:24136188 Mrpl1 Rat sunitinib increases expression ISO MRPL1 (Homo sapiens) 6480464 Sunitinib results in increased expression of MRPL1 mRNA CTD PMID:31533062 Mrpl1 Rat temozolomide increases expression ISO MRPL1 (Homo sapiens) 6480464 Temozolomide results in increased expression of MRPL1 mRNA CTD PMID:31758290 Mrpl1 Rat testosterone increases expression ISO MRPL1 (Homo sapiens) 6480464 Testosterone results in increased expression of MRPL1 mRNA CTD PMID:33359661 Mrpl1 Rat thapsigargin increases expression ISO MRPL1 (Homo sapiens) 6480464 Thapsigargin results in increased expression of MRPL1 mRNA CTD PMID:22378314 Mrpl1 Rat thimerosal increases expression ISO MRPL1 (Homo sapiens) 6480464 Thimerosal results in increased expression of MRPL1 mRNA CTD PMID:27188386 Mrpl1 Rat titanium dioxide decreases methylation ISO Mrpl1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of MRPL1 gene and titanium dioxide results in decreased methylation of MRPL1 promoter CTD PMID:35295148 Mrpl1 Rat tolcapone decreases expression EXP 6480464 tolcapone results in decreased expression of MRPL1 mRNA CTD PMID:24136188 Mrpl1 Rat tunicamycin increases expression ISO MRPL1 (Homo sapiens) 6480464 Tunicamycin results in increased expression of MRPL1 mRNA CTD PMID:22378314 Mrpl1 Rat urethane decreases expression ISO MRPL1 (Homo sapiens) 6480464 Urethane results in decreased expression of MRPL1 mRNA CTD PMID:28818685 Mrpl1 Rat valproic acid increases expression ISO MRPL1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of MRPL1 mRNA CTD PMID:23179753 Mrpl1 Rat valproic acid affects expression ISO MRPL1 (Homo sapiens) 6480464 Valproic Acid affects the expression of MRPL1 mRNA CTD PMID:25979313 Mrpl1 Rat vorinostat increases expression ISO MRPL1 (Homo sapiens) 6480464 vorinostat results in increased expression of MRPL1 mRNA CTD PMID:27188386
1,2-dimethylhydrazine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 2-methylcholine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) aflatoxin M1 (ISO) arsenite(3-) (ISO) atrazine (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) buspirone (EXP) Butylbenzyl phthalate (ISO) C60 fullerene (EXP) cadmium atom (ISO) cadmium dichloride (EXP) CGP 52608 (ISO) chlorpyrifos (ISO) copper(II) sulfate (ISO) curcumin (ISO) cylindrospermopsin (ISO) dibutyl phthalate (ISO) dicrotophos (ISO) diethyl phthalate (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) diquat (ISO) finasteride (EXP) flutamide (EXP) formaldehyde (ISO) FR900359 (ISO) gentamycin (EXP) hydrogen peroxide (ISO) ivermectin (ISO) methylmercury chloride (ISO) nickel sulfate (ISO) paracetamol (ISO) perfluorooctanoic acid (ISO) pinostrobin (ISO) pirinixic acid (ISO) rac-lactic acid (ISO) silicon dioxide (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sulindac (EXP) sunitinib (ISO) temozolomide (ISO) testosterone (ISO) thapsigargin (ISO) thimerosal (ISO) titanium dioxide (ISO) tolcapone (EXP) tunicamycin (ISO) urethane (ISO) valproic acid (ISO) vorinostat (ISO)
Mrpl1 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 13,604,498 - 13,663,633 (-) NCBI GRCr8 mRatBN7.2 14 13,300,522 - 13,359,654 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 13,300,522 - 13,359,721 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 13,267,793 - 13,327,734 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 14,567,648 - 14,627,589 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 13,284,132 - 13,344,073 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 14,951,507 - 15,008,136 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 14,951,495 - 15,008,150 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 14,893,399 - 14,944,235 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 14,813,544 - 14,872,680 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 14,813,544 - 14,873,482 (-) NCBI Celera 14 13,347,923 - 13,406,905 (-) NCBI Celera Cytogenetic Map 14 p22 NCBI
MRPL1 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 77,862,830 - 77,952,785 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 77,862,830 - 77,952,785 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 78,783,984 - 78,873,939 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 79,002,829 - 79,092,968 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 79,141,079 - 79,231,116 NCBI Celera 4 76,085,074 - 76,174,865 (+) NCBI Celera Cytogenetic Map 4 q21.1 NCBI HuRef 4 74,535,751 - 74,625,006 (+) NCBI HuRef CHM1_1 4 78,760,602 - 78,850,723 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 81,202,852 - 81,293,608 (+) NCBI T2T-CHM13v2.0
Mrpl1 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 96,357,357 - 96,414,586 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 96,357,352 - 96,414,586 (+) Ensembl GRCm39 Ensembl GRCm38 5 96,209,498 - 96,266,727 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 96,209,493 - 96,266,727 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 96,639,134 - 96,695,728 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 96,450,417 - 96,507,011 (+) NCBI MGSCv36 mm8 Celera 5 93,553,498 - 93,610,078 (+) NCBI Celera Cytogenetic Map 5 E3 NCBI cM Map 5 47.29 NCBI
Mrpl1 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955433 2,353,844 - 2,437,743 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955433 2,327,830 - 2,436,198 (+) NCBI ChiLan1.0 ChiLan1.0
MRPL1 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 52,109,970 - 52,203,131 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 52,296,559 - 52,389,512 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 46,239,491 - 46,331,917 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 52,084,870 - 52,177,179 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 52,085,053 - 52,176,796 (-) Ensembl panpan1.1 panPan2
MRPL1 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 32 2,307,485 - 2,457,587 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 32 2,363,454 - 2,496,034 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 32 39,434,637 - 39,583,984 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 32 2,333,281 - 2,484,071 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 32 2,333,332 - 2,523,023 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 32 2,332,231 - 2,472,209 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 32 2,280,434 - 2,419,871 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 32 37,752,366 - 37,892,634 (-) NCBI UU_Cfam_GSD_1.0
Mrpl1 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405285 9,878,695 - 9,958,409 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936676 1,553,406 - 1,627,659 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936676 1,549,018 - 1,628,548 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MRPL1 (Sus scrofa - pig)
MRPL1 (Chlorocebus sabaeus - green monkey)
Mrpl1 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 128 Count of miRNA genes: 95 Interacting mature miRNAs: 99 Transcripts: ENSRNOT00000002834, ENSRNOT00000039083 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1300114 Srn2 Serum renin concentration QTL 2 3.27 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 14 3813074 21217635 Rat 2293089 Iddm31 Insulin dependent diabetes mellitus QTL 31 4.7 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 14 3813074 18274691 Rat 1581500 Renag1 Renal agenesis QTL 1 kidney development trait (VT:0000527) percentage of study population developing unilateral renal agenesis during a period of time (CMO:0000940) 14 8170668 68298175 Rat 731183 Pia20 Pristane induced arthritis QTL 20 3.55 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 14 9088978 39057237 Rat 631212 Bw5 Body weight QTL5 5.43 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 14 11030812 30320092 Rat 2302277 Gluco38 Glucose level QTL 38 5.8 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 11030622 28035204 Rat 1331740 Bw26 Body weight QTL 26 3.028 body mass (VT:0001259) body weight (CMO:0000012) 14 3813074 30767156 Rat 619619 Rf4 Renal disease susceptibility QTL 4 4.1 0.002 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 14 1 32754612 Rat 1358296 Ael3 Aortic elastin QTL 3 3.7 0.00051 aorta elastin amount (VT:0003905) aortic elastin 14 8267090 53267090 Rat 70195 Mcs8 Mammary carcinoma susceptibility QTL 8 4.28 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 14 3813074 24531477 Rat 2300183 Bmd60 Bone mineral density QTL 60 5.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 14 1 26541967 Rat 631839 Niddm37 Non-insulin dependent diabetes mellitus QTL 37 3.37 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 11030622 95876975 Rat 634352 Apr6 Acute phase response QTL 6 3.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 14 1 41131407 Rat 2300159 Bmd61 Bone mineral density QTL 61 5.3 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 14 1 26541967 Rat 70204 Niddm20 Non-insulin dependent diabetes mellitus QTL 20 5.1 0.000008 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 14 1217606 16960180 Rat 2302045 Pia39 Pristane induced arthritis QTL 39 4.9 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G2a level (CMO:0002116) 14 8267090 53267090 Rat
RH142878
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 13,311,044 - 13,311,284 (+) MAPPER mRatBN7.2 mRatBN7.2 14 13,311,044 - 13,311,284 (-) MAPPER mRatBN7.2 Rnor_6.0 14 14,962,031 - 14,962,270 NCBI Rnor6.0 Rnor_6.0 8 56,491,312 - 56,491,551 NCBI Rnor6.0 Rnor_5.0 14 14,903,923 - 14,904,162 UniSTS Rnor5.0 Rnor_5.0 8 55,073,981 - 55,074,220 UniSTS Rnor5.0 RGSC_v3.4 14 14,824,067 - 14,824,306 UniSTS RGSC3.4 Celera 14 13,358,445 - 13,358,684 UniSTS Cytogenetic Map 14 p22 UniSTS
RH143703
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 14 13,663,563 - 13,664,233 (+) Marker Load Pipeline mRatBN7.2 14 13,359,587 - 13,360,257 (+) MAPPER mRatBN7.2 Rnor_6.0 14 15,008,179 - 15,008,848 NCBI Rnor6.0 Rnor_5.0 14 14,949,656 - 14,950,325 UniSTS Rnor5.0 RGSC_v3.4 14 14,872,723 - 14,873,392 UniSTS RGSC3.4 Celera 14 13,406,948 - 13,407,617 UniSTS Cytogenetic Map 14 p22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
9
28
94
71
72
43
22
43
6
171
70
77
43
51
29
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000002834 ⟹ ENSRNOP00000002834
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 13,300,522 - 13,351,447 (-) Ensembl Rnor_6.0 Ensembl 14 14,951,602 - 15,008,119 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000039083 ⟹ ENSRNOP00000036682
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 13,300,522 - 13,359,721 (-) Ensembl Rnor_6.0 Ensembl 8 56,411,911 - 56,502,069 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000084617 ⟹ ENSRNOP00000069244
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 13,300,522 - 13,351,578 (-) Ensembl Rnor_6.0 Ensembl 14 14,951,495 - 15,008,150 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000085278 ⟹ ENSRNOP00000070016
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 13,300,522 - 13,351,447 (-) Ensembl Rnor_6.0 Ensembl 8 56,451,240 - 56,501,979 (+) Ensembl
RefSeq Acc Id:
NM_001105997 ⟹ NP_001099467
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 13,604,499 - 13,663,521 (-) NCBI mRatBN7.2 14 13,300,523 - 13,359,545 (-) NCBI Rnor_6.0 14 14,951,507 - 15,008,136 (-) NCBI Rnor_5.0 14 14,893,399 - 14,944,235 (-) NCBI RGSC_v3.4 14 14,813,544 - 14,872,680 (-) RGD Celera 14 13,347,923 - 13,406,905 (-) RGD
Sequence:
AATCCGGAACAGTCAACATGGCGGCGGCCGCAAGGTACCTCGGTAGAGTCTTGATACATCATCAAAGGCATAGTCTCTGCAAGATGGCTCACCAGGCAGCTTTTTACCCCTGTTCTCTAAACAGTCTC TTGCCCAACAGACATTTTGCTGCTGCTGCTGCAAAGTCTGCAAGAAAAAATAAAAAAGGTGCTAAGGAAAAGACATCAGATGAAAAACCAGTTGATGATATAGAGAAAATAAAGTCATATACCTACAT GGAAAGTGAGCCTGAAGACGATGTCTATTTAAAACGCTTATACCCACGGCGGATCTATGAAGTAGAGAAAGCTATTCACTTACTTAAGAAGTTTCAAGTCCTGGACTTTACCAATCCAAAGCAAGGTG TTTATCTTGACTTAACATTAGATATGGCATTGGGAAAAAAGAAAAAAGTGGAACCATTTGCCAGCGTTATTGCTCTCCCACACCCTTTCTCGTCAGAAGTCAACAAAGTTGCTGTGTTTACAGGGAAT GCATCAGAAATTAAAATAGCAGAAGAAAATGGAGCTGCGTTTGCAGGAGGAGCAGATCTAGTTAAGAAGATCTTGGATGATGAGGTTGTTGTGGACTTTTATGTAGCTGTTCCAGAAATAATGGGCGA ACTTAACCCGTTAAGGAAGAAACTGAAAAAAAGATTTCCAAAGGCTACTAGAAATTCTATTGGCCGTGACATCCCCAAAATGCTTGAATTATTTAAAACTGCACATGAAATTATGGTAGATGAAGAAA GGCAGAACTTCCTCAGCACCAAAATAGCAACGTTGGATATGCCAAGTGACCAGTTAGCTGCCAATCTTCAAGCTGTCATAAATGAGGTCTGCAGGCACAGACCACTGAATCTGGGTCCATTTGTGGTC CGTGCCTTCCTTCGTAGTTCCACCAGTGAAGGTTTGCTACTGAAGACTGACTCGCTCTTACCCAAAGAGGCTGGAAACGCAGAAGCTGCCTAGAAGTGTTGTATTGTGATATTATTGGGGGTGTGTAG ACCCCCAATGTTGTGTGTCAAGAAACAACAAAGACATCTATAAAACTGTTTAATTTCTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
XM_039091670 ⟹ XP_038947598
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 13,604,498 - 13,646,645 (-) NCBI mRatBN7.2 14 13,300,522 - 13,342,710 (-) NCBI
RefSeq Acc Id:
XM_039091672 ⟹ XP_038947600
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 13,604,498 - 13,663,606 (-) NCBI mRatBN7.2 14 13,300,522 - 13,359,631 (-) NCBI
RefSeq Acc Id:
XM_039091673 ⟹ XP_038947601
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 13,639,618 - 13,663,633 (-) NCBI mRatBN7.2 14 13,335,647 - 13,359,654 (-) NCBI
RefSeq Acc Id:
XM_063272899 ⟹ XP_063128969
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 13,606,658 - 13,663,633 (-) NCBI
RefSeq Acc Id:
NP_001099467 ⟸ NM_001105997
- UniProtKB:
B5DER4 (UniProtKB/TrEMBL), F1M9A4 (UniProtKB/TrEMBL)
- Sequence:
MAAAARYLGRVLIHHQRHSLCKMAHQAAFYPCSLNSLLPNRHFAAAAAKSARKNKKGAKEKTSDEKPVDDIEKIKSYTYMESEPEDDVYLKRLYPRRIYEVEKAIHLLKKFQVLDFTNPKQGVYLDLT LDMALGKKKKVEPFASVIALPHPFSSEVNKVAVFTGNASEIKIAEENGAAFAGGADLVKKILDDEVVVDFYVAVPEIMGELNPLRKKLKKRFPKATRNSIGRDIPKMLELFKTAHEIMVDEERQNFLS TKIATLDMPSDQLAANLQAVINEVCRHRPLNLGPFVVRAFLRSSTSEGLLLKTDSLLPKEAGNAEAA
hide sequence
Ensembl Acc Id:
ENSRNOP00000069244 ⟸ ENSRNOT00000084617
Ensembl Acc Id:
ENSRNOP00000002834 ⟸ ENSRNOT00000002834
RefSeq Acc Id:
XP_038947600 ⟸ XM_039091672
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038947598 ⟸ XM_039091670
- Peptide Label:
isoform X1
- UniProtKB:
D3ZFE9 (UniProtKB/TrEMBL), F1M9A4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038947601 ⟸ XM_039091673
- Peptide Label:
isoform X4
Ensembl Acc Id:
ENSRNOP00000036682 ⟸ ENSRNOT00000039083
Ensembl Acc Id:
ENSRNOP00000070016 ⟸ ENSRNOT00000085278
RefSeq Acc Id:
XP_063128969 ⟸ XM_063272899
- Peptide Label:
isoform X3
RGD ID: 13699203
Promoter ID: EPDNEW_R9728
Type: multiple initiation site
Name: Mrpl1_1
Description: mitochondrial ribosomal protein L1
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 14 15,008,138 - 15,008,198 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Mrpl1
mitochondrial ribosomal protein L1
LOC100359687
mitochondrial ribosomal protein L1-like
Data merged from RGD:2325044
737654
PROVISIONAL
2010-05-20
LOC100359687
mitochondrial ribosomal protein L1-like
Symbol and Name status set to provisional
70820
PROVISIONAL
2008-04-30
Mrpl1
mitochondrial ribosomal protein L1
Mrpl1_predicted
mitochondrial ribosomal protein L1 (predicted)
'predicted' is removed
2292626
APPROVED
2005-01-12
Mrpl1_predicted
mitochondrial ribosomal protein L1 (predicted)
Symbol and Name status set to approved
70820
APPROVED