Symbol:
Slc39a4
Name:
solute carrier family 39 member 4
RGD ID:
1306701
Description:
Predicted to enable several functions, including monoatomic cation transmembrane transporter activity; zinc ion binding activity; and zinc ion sensor activity. Predicted to be involved in intracellular zinc ion homeostasis and zinc ion import across plasma membrane. Predicted to act upstream of or within cellular response to zinc ion starvation. Predicted to be located in apical plasma membrane and recycling endosome membrane. Predicted to be active in plasma membrane. Human ortholog(s) of this gene implicated in acrodermatitis enteropathica. Orthologous to human SLC39A4 (solute carrier family 39 member 4); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC300051; MGC156705; solute carrier family 39 (zinc transporter), member 4; zinc transporter ZIP4; ZIP-4; zrt- and Irt-like protein 4
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SLC39A4 (solute carrier family 39 member 4) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Slc39a4 (solute carrier family 39 (zinc transporter), member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Slc39a4 (solute carrier family 39 member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SLC39A4 (solute carrier family 39 member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SLC39A4 (solute carrier family 39 member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Slc39a4 (solute carrier family 39 member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SLC39A4 (solute carrier family 39 member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SLC39A4 (solute carrier family 39 member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Slc39a4 (solute carrier family 39 member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
SLC39A4 (solute carrier family 39 member 4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Slc39a4 (solute carrier family 39 (zinc transporter), member 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
slc39a4 (solute carrier family 39 member 4)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
foi
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
slc39a4
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 110,214,017 - 110,218,202 (-) NCBI GRCr8 mRatBN7.2 7 108,333,368 - 108,337,553 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 108,333,381 - 108,337,553 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 110,075,214 - 110,079,418 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 112,298,788 - 112,302,992 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 112,259,628 - 112,263,832 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 117,675,718 - 117,682,586 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 117,675,720 - 117,680,004 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 117,663,813 - 117,667,986 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 114,661,925 - 114,666,098 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 114,696,147 - 114,700,327 (-) NCBI Celera 7 104,683,583 - 104,687,756 (-) NCBI Celera Cytogenetic Map 7 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Slc39a4 Rat acrodermatitis enteropathica ISO RGD:1315470 8554872 ClinVar Annotator: match by term: Acrodermatitis enteropathica zinc deficiency type | ClinVar Annotator: match by more ... ClinVar PMID:11035780|PMID:11254458|PMID:12032886|PMID:12068297|PMID:12787121|PMID:12955721|PMID:14709598|PMID:16199547|PMID:16819703|PMID:19370757|PMID:19416242|PMID:20981092|PMID:21165302|PMID:21762381|PMID:24033266|PMID:25741868|PMID:26351177|PMID:28188634|PMID:28492532|PMID:30174688|PMID:31130284|PMID:31979155|PMID:33837739|PMID:34625996 Slc39a4 Rat Brown-Vialetto-Van Laere syndrome 2 ISO RGD:1315470 8554872 ClinVar Annotator: match by term: Brown-Vialetto-van Laere syndrome 2 ClinVar PMID:20301336|PMID:20447487|PMID:21109228|PMID:23289980|PMID:24253200|PMID:28492532|PMID:28824526 Slc39a4 Rat epidermolysis bullosa simplex with muscular dystrophy ISO RGD:1315470 8554872 ClinVar Annotator: match by term: Epidermolysis bullosa simplex 5B, with muscular dystrophy ClinVar PMID:20301336|PMID:20447487|PMID:21109228|PMID:23289980|PMID:24253200|PMID:28492532|PMID:28824526 Slc39a4 Rat genetic disease ISO RGD:1315470 8554872 ClinVar Annotator: match by term: Inborn genetic diseases ClinVar PMID:12032886|PMID:12955721|PMID:16199547|PMID:21762381|PMID:25741868|PMID:28492532 Slc39a4 Rat holoprosencephaly ISO RGD:1315470 8554872 ClinVar Annotator: match by term: Holoprosencephaly sequence ClinVar PMID:28492532 Slc39a4 Rat Recombinant Chromosome 8 Syndrome ISO RGD:1315470 8554872 ClinVar Annotator: match by term: Recombinant 8 syndrome ClinVar PMID:31690835
Only show annotations with direct experimental evidence (0 objects hidden)
Slc39a4 Rat (-)-epigallocatechin 3-gallate increases expression ISO RGD:1315470 6480464 epigallocatechin gallate results in increased expression of SLC39A4 mRNA CTD PMID:20471814 Slc39a4 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:1552511 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of SLC39A4 mRNA CTD PMID:36331819 Slc39a4 Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:1552511 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SLC39A4 mRNA CTD PMID:22206623 Slc39a4 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1552511 6480464 1,2-Dimethylhydrazine results in decreased expression of SLC39A4 mRNA CTD PMID:22206623 Slc39a4 Rat 17beta-estradiol increases expression ISO RGD:1552511 6480464 Estradiol results in increased expression of SLC39A4 mRNA CTD PMID:15289156 Slc39a4 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of SLC39A4 mRNA CTD PMID:32145629 Slc39a4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SLC39A4 mRNA CTD PMID:21215274 Slc39a4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1315470 6480464 Tetrachlorodibenzodioxin results in increased expression of SLC39A4 mRNA CTD PMID:20106945|PMID:21632981 Slc39a4 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1552511 6480464 Tetrachlorodibenzodioxin affects the expression of SLC39A4 mRNA CTD PMID:21570461 Slc39a4 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO RGD:1552511 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of SLC39A4 mRNA CTD PMID:38648751 Slc39a4 Rat 4,4'-diaminodiphenylmethane decreases expression ISO RGD:1552511 6480464 4,4'-diaminodiphenylmethane results in decreased expression of SLC39A4 mRNA CTD PMID:18648102 Slc39a4 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1552511 6480464 bisphenol S results in increased expression of SLC39A4 mRNA CTD PMID:30951980 Slc39a4 Rat 4,4'-sulfonyldiphenol affects methylation ISO RGD:1552511 6480464 bisphenol S affects the methylation of SLC39A4 gene CTD PMID:31683443 Slc39a4 Rat 4,4'-sulfonyldiphenol increases methylation ISO RGD:1552511 6480464 bisphenol S results in increased methylation of SLC39A4 exon CTD PMID:33297965 Slc39a4 Rat 4-hydroxyphenyl retinamide increases expression ISO RGD:1552511 6480464 Fenretinide results in increased expression of SLC39A4 mRNA CTD PMID:28973697 Slc39a4 Rat 4-nitrophenol decreases expression ISO RGD:1552511 6480464 4-nitrophenol results in decreased expression of SLC39A4 mRNA CTD PMID:34673133 Slc39a4 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of SLC39A4 mRNA CTD PMID:22504374 Slc39a4 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of SLC39A4 mRNA CTD PMID:24780913 Slc39a4 Rat acrylamide decreases expression ISO RGD:1552511 6480464 Acrylamide results in decreased expression of SLC39A4 mRNA CTD PMID:35032568 Slc39a4 Rat actinomycin D multiple interactions ISO RGD:1552511 6480464 Dactinomycin inhibits the reaction [Zinc deficiency results in increased expression of SLC39A4 mRNA]; Dactinomycin inhibits more ... CTD PMID:18020946 Slc39a4 Rat ammonium chloride multiple interactions ISO RGD:1315470 6480464 Ammonium Chloride inhibits the reaction [Zinc results in increased degradation of SLC39A4 protein] CTD PMID:17202136 Slc39a4 Rat aristolochic acid A decreases expression ISO RGD:1315470 6480464 aristolochic acid I results in decreased expression of SLC39A4 mRNA CTD PMID:33212167 Slc39a4 Rat arsane affects methylation ISO RGD:1315470 6480464 Arsenic affects the methylation of SLC39A4 gene CTD PMID:25304211 Slc39a4 Rat arsenic atom affects methylation ISO RGD:1315470 6480464 Arsenic affects the methylation of SLC39A4 gene CTD PMID:25304211 Slc39a4 Rat Azoxymethane multiple interactions ISO RGD:1552511 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of SLC39A4 more ... CTD PMID:29950665 Slc39a4 Rat benzo[a]pyrene increases expression ISO RGD:1315470 6480464 Benzo(a)pyrene results in increased expression of SLC39A4 mRNA CTD PMID:20106945 Slc39a4 Rat benzo[a]pyrene increases methylation ISO RGD:1315470 6480464 Benzo(a)pyrene results in increased methylation of SLC39A4 exon CTD PMID:27901495 Slc39a4 Rat benzo[a]pyrene affects methylation ISO RGD:1315470 6480464 Benzo(a)pyrene affects the methylation of SLC39A4 promoter CTD PMID:27901495 Slc39a4 Rat benzo[a]pyrene increases expression ISO RGD:1552511 6480464 Benzo(a)pyrene results in increased expression of SLC39A4 mRNA CTD PMID:27195522 Slc39a4 Rat benzo[a]pyrene decreases expression ISO RGD:1552511 6480464 Benzo(a)pyrene results in decreased expression of SLC39A4 mRNA CTD PMID:22228805 Slc39a4 Rat beta-lapachone increases expression ISO RGD:1315470 6480464 beta-lapachone results in increased expression of SLC39A4 mRNA CTD PMID:38218311 Slc39a4 Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:1552511 6480464 Diethylhexyl Phthalate results in decreased expression of SLC39A4 mRNA CTD PMID:19850644 Slc39a4 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of SLC39A4 mRNA CTD PMID:25181051 Slc39a4 Rat bisphenol A increases expression ISO RGD:1552511 6480464 bisphenol A results in increased expression of SLC39A4 mRNA CTD PMID:32156529 Slc39a4 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SLC39A4 mRNA CTD PMID:32145629|PMID:35192832 Slc39a4 Rat bisphenol A affects expression ISO RGD:1315470 6480464 bisphenol A affects the expression of SLC39A4 mRNA CTD PMID:30903817 Slc39a4 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SLC39A4 mRNA CTD PMID:30816183 Slc39a4 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of SLC39A4 mRNA CTD PMID:25653005 Slc39a4 Rat cadmium dichloride affects expression EXP 6480464 Cadmium Chloride affects the expression of SLC39A4 mRNA CTD PMID:22110744 Slc39a4 Rat cadmium dichloride multiple interactions EXP 6480464 zinc chloride inhibits the reaction [Cadmium Chloride results in increased expression of SLC39A4 mRNA] CTD PMID:25653005 Slc39a4 Rat calcitriol decreases expression ISO RGD:1315470 6480464 Calcitriol results in decreased expression of SLC39A4 mRNA CTD PMID:20089671 Slc39a4 Rat cannabidiol increases expression ISO RGD:1552511 6480464 Cannabidiol results in increased expression of SLC39A4 mRNA CTD PMID:21542829|PMID:22178458 Slc39a4 Rat carbon nanotube decreases expression ISO RGD:1552511 6480464 Nanotubes, Carbon analog results in decreased expression of SLC39A4 mRNA CTD PMID:25620056 Slc39a4 Rat cefaloridine increases expression EXP 6480464 Cephaloridine results in increased expression of SLC39A4 mRNA CTD PMID:18500788 Slc39a4 Rat cisplatin increases expression ISO RGD:1315470 6480464 Cisplatin results in increased expression of SLC39A4 mRNA CTD PMID:24280081 Slc39a4 Rat cisplatin increases expression ISO RGD:1552511 6480464 Cisplatin results in increased expression of SLC39A4 mRNA CTD PMID:24280081 Slc39a4 Rat cobalt dichloride decreases expression ISO RGD:1315470 6480464 cobaltous chloride results in decreased expression of SLC39A4 mRNA CTD PMID:19376846 Slc39a4 Rat coumestrol increases expression ISO RGD:1315470 6480464 Coumestrol results in increased expression of SLC39A4 mRNA CTD PMID:19167446 Slc39a4 Rat cycloheximide multiple interactions ISO RGD:1552511 6480464 Cycloheximide inhibits the reaction [Zinc deficiency results in increased expression of SLC39A4 mRNA]; Cycloheximide inhibits more ... CTD PMID:18020946 Slc39a4 Rat cyclosporin A decreases expression ISO RGD:1315470 6480464 Cyclosporine results in decreased expression of SLC39A4 mRNA CTD PMID:25562108 Slc39a4 Rat cyclosporin A decreases methylation ISO RGD:1315470 6480464 Cyclosporine results in decreased methylation of SLC39A4 promoter CTD PMID:27989131 Slc39a4 Rat DDE increases expression ISO RGD:1315470 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of SLC39A4 mRNA CTD PMID:38568856 Slc39a4 Rat dextran sulfate multiple interactions ISO RGD:1552511 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of SLC39A4 more ... CTD PMID:29950665 Slc39a4 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of SLC39A4 mRNA CTD PMID:21266533 Slc39a4 Rat diethylstilbestrol decreases expression ISO RGD:1552511 6480464 Diethylstilbestrol results in decreased expression of SLC39A4 mRNA CTD PMID:17394237 Slc39a4 Rat diethylstilbestrol increases expression ISO RGD:1552511 6480464 Diethylstilbestrol results in increased expression of SLC39A4 mRNA CTD PMID:15289156 Slc39a4 Rat dioxygen multiple interactions ISO RGD:1552511 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of SLC39A4 mRNA CTD PMID:30529165 Slc39a4 Rat epoxiconazole decreases expression ISO RGD:1552511 6480464 epoxiconazole results in decreased expression of SLC39A4 mRNA CTD PMID:35436446 Slc39a4 Rat ethyl methanesulfonate decreases expression ISO RGD:1315470 6480464 Ethyl Methanesulfonate results in decreased expression of SLC39A4 mRNA CTD PMID:23649840 Slc39a4 Rat folic acid multiple interactions ISO RGD:1552511 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SLC39A4 mRNA CTD PMID:22206623 Slc39a4 Rat formaldehyde decreases expression ISO RGD:1315470 6480464 Formaldehyde results in decreased expression of SLC39A4 mRNA CTD PMID:23649840 Slc39a4 Rat furan increases methylation EXP 6480464 furan results in increased methylation of SLC39A4 gene CTD PMID:22079235 Slc39a4 Rat genistein increases expression ISO RGD:1552511 6480464 Genistein results in increased expression of SLC39A4 mRNA CTD PMID:15289156 Slc39a4 Rat GSK-J4 decreases expression ISO RGD:1315470 6480464 GSK-J4 results in decreased expression of SLC39A4 mRNA CTD PMID:29301935 Slc39a4 Rat hydrogen peroxide affects expression ISO RGD:1315470 6480464 Hydrogen Peroxide affects the expression of SLC39A4 mRNA CTD PMID:20044591 Slc39a4 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of SLC39A4 mRNA CTD PMID:21396975 Slc39a4 Rat inulin multiple interactions ISO RGD:1552511 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of SLC39A4 mRNA CTD PMID:36331819 Slc39a4 Rat irinotecan affects expression EXP 6480464 Irinotecan affects the expression of SLC39A4 mRNA CTD PMID:20097248 Slc39a4 Rat lead diacetate decreases expression EXP 6480464 lead acetate results in decreased expression of SLC39A4 mRNA CTD PMID:22641619 Slc39a4 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of SLC39A4 mRNA CTD PMID:24136188 Slc39a4 Rat Licochalcone B increases expression ISO RGD:1315470 6480464 licochalcone B results in increased expression of SLC39A4 mRNA CTD PMID:33647349 Slc39a4 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of SLC39A4 mRNA CTD PMID:22504374 Slc39a4 Rat methyl beta-cyclodextrin multiple interactions ISO RGD:1315470 6480464 methyl-beta-cyclodextrin inhibits the reaction [Zinc results in increased degradation of SLC39A4 protein] CTD PMID:17202136 Slc39a4 Rat methyl methanesulfonate decreases expression ISO RGD:1315470 6480464 Methyl Methanesulfonate results in decreased expression of SLC39A4 mRNA CTD PMID:23649840 Slc39a4 Rat N(4)-hydroxycytidine decreases expression ISO RGD:1552511 6480464 N(4)-hydroxycytidine results in decreased expression of SLC39A4 mRNA CTD PMID:37748715 Slc39a4 Rat N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine increases expression ISO RGD:1315470 6480464 N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine results in increased expression of SLC39A4 mRNA CTD PMID:19083439 Slc39a4 Rat N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine increases expression ISO RGD:1552511 6480464 N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine results in increased expression of SLC39A4 mRNA CTD PMID:18020946 Slc39a4 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO RGD:1315470 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [Zinc results in increased degradation of SLC39A4 protein] CTD PMID:17202136 Slc39a4 Rat N-nitrosodiethylamine increases expression ISO RGD:1552511 6480464 Diethylnitrosamine results in increased expression of SLC39A4 mRNA CTD PMID:24535843 Slc39a4 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of SLC39A4 mRNA CTD PMID:22110744 Slc39a4 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of SLC39A4 mRNA CTD PMID:24136188 Slc39a4 Rat nitrates multiple interactions ISO RGD:1552511 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of SLC39A4 more ... CTD PMID:35964746 Slc39a4 Rat okadaic acid increases expression ISO RGD:1315470 6480464 Okadaic Acid results in increased expression of SLC39A4 mRNA CTD PMID:38832940 Slc39a4 Rat oxycodone increases expression EXP 6480464 Oxycodone results in increased expression of SLC39A4 mRNA CTD PMID:23439660 Slc39a4 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1552511 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of SLC39A4 mRNA; [perfluorooctane sulfonic more ... CTD PMID:36331819 Slc39a4 Rat phenobarbital increases expression ISO RGD:1552511 6480464 Phenobarbital results in increased expression of SLC39A4 mRNA CTD PMID:19482888|PMID:31836555 Slc39a4 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of SLC39A4 mRNA CTD PMID:28520973 Slc39a4 Rat phenobarbital multiple interactions ISO RGD:1552511 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of SLC39A4 mRNA] CTD PMID:19482888 Slc39a4 Rat pirinixic acid decreases expression ISO RGD:1552511 6480464 pirinixic acid results in decreased expression of SLC39A4 mRNA CTD PMID:17426115 Slc39a4 Rat progesterone affects expression ISO RGD:1552511 6480464 Progesterone affects the expression of SLC39A4 mRNA CTD PMID:17251523 Slc39a4 Rat propiconazole decreases expression ISO RGD:1552511 6480464 propiconazole results in decreased expression of SLC39A4 mRNA CTD PMID:21278054 Slc39a4 Rat quercetin increases expression ISO RGD:1315470 6480464 Quercetin results in increased expression of SLC39A4 mRNA CTD PMID:21632981 Slc39a4 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of SLC39A4 mRNA CTD PMID:19013527|PMID:28374803 Slc39a4 Rat rotenone increases expression ISO RGD:1315470 6480464 Rotenone results in increased expression of SLC39A4 mRNA CTD PMID:29955902 Slc39a4 Rat silver atom increases expression ISO RGD:1552511 6480464 Silver results in increased expression of SLC39A4 mRNA CTD PMID:27131904 Slc39a4 Rat silver(0) increases expression ISO RGD:1552511 6480464 Silver results in increased expression of SLC39A4 mRNA CTD PMID:27131904 Slc39a4 Rat sodium arsenate decreases expression ISO RGD:1552511 6480464 sodium arsenate results in decreased expression of SLC39A4 mRNA CTD PMID:21795629 Slc39a4 Rat sodium arsenite decreases expression ISO RGD:1315470 6480464 sodium arsenite results in decreased expression of SLC39A4 mRNA CTD PMID:38568856 Slc39a4 Rat sucrose multiple interactions ISO RGD:1315470 6480464 Sucrose inhibits the reaction [Zinc results in increased degradation of SLC39A4 protein] CTD PMID:17202136 Slc39a4 Rat tetrachloromethane decreases expression ISO RGD:1552511 6480464 Carbon Tetrachloride results in decreased expression of SLC39A4 mRNA CTD PMID:31919559 Slc39a4 Rat thiram decreases expression ISO RGD:1315470 6480464 Thiram results in decreased expression of SLC39A4 mRNA CTD PMID:38568856 Slc39a4 Rat titanium dioxide multiple interactions ISO RGD:1552511 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of SLC39A4 more ... CTD PMID:29950665 Slc39a4 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of SLC39A4 mRNA CTD PMID:33387578 Slc39a4 Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of SLC39A4 mRNA CTD PMID:30589522 Slc39a4 Rat triptonide increases expression ISO RGD:1552511 6480464 triptonide results in increased expression of SLC39A4 mRNA CTD PMID:33045310 Slc39a4 Rat trovafloxacin decreases expression ISO RGD:1552511 6480464 trovafloxacin results in decreased expression of SLC39A4 mRNA CTD PMID:35537566 Slc39a4 Rat valproic acid decreases expression ISO RGD:1315470 6480464 Valproic Acid results in decreased expression of SLC39A4 mRNA CTD PMID:29154799 Slc39a4 Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of SLC39A4 mRNA CTD PMID:35594946 Slc39a4 Rat valproic acid increases methylation ISO RGD:1315470 6480464 Valproic Acid results in increased methylation of SLC39A4 gene CTD PMID:29154799 Slc39a4 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of SLC39A4 mRNA CTD PMID:19015723 Slc39a4 Rat zinc atom multiple interactions ISO RGD:1315470 6480464 Ammonium Chloride inhibits the reaction [Zinc results in increased degradation of SLC39A4 protein]; benzyloxycarbonylleucyl-leucyl-leucine aldehyde more ... CTD PMID:17202136 Slc39a4 Rat zinc atom increases expression ISO RGD:1552511 6480464 Zinc deficiency results in increased expression of SLC39A4 mRNA; Zinc deficiency results in increased expression more ... CTD PMID:12801924|PMID:15358787|PMID:18020946 Slc39a4 Rat zinc atom affects localization ISO RGD:1552511 6480464 Zinc affects the localization of SLC39A4 protein; Zinc deficiency affects the localization of SLC39A4 protein CTD PMID:12801924|PMID:14709598|PMID:15358787 Slc39a4 Rat zinc atom increases response to substance ISO RGD:1552511 6480464 SLC39A4 gene mutant form results in increased susceptibility to Zinc deficiency CTD PMID:17483098 Slc39a4 Rat zinc atom increases uptake ISO RGD:1552511 6480464 SLC39A4 protein results in increased uptake of Zinc CTD PMID:12801924|PMID:14709598|PMID:15322118 Slc39a4 Rat zinc atom decreases expression ISO RGD:1315470 6480464 Zinc results in decreased expression of SLC39A4 mRNA; Zinc results in decreased expression of SLC39A4 more ... CTD PMID:15753530|PMID:17202136 Slc39a4 Rat zinc atom multiple interactions ISO RGD:1552511 6480464 Cycloheximide inhibits the reaction [Zinc deficiency results in increased expression of SLC39A4 mRNA]; Cycloheximide inhibits more ... CTD PMID:12801924|PMID:18020946 Slc39a4 Rat zinc atom affects expression ISO RGD:1315470 6480464 Zinc affects the expression of SLC39A4 protein CTD PMID:20479680 Slc39a4 Rat zinc atom decreases expression ISO RGD:1552511 6480464 Zinc deficiency results in decreased expression of SLC39A4 mRNA; Zinc results in decreased expression of more ... CTD PMID:12514265|PMID:12801924|PMID:17202136|PMID:18020946 Slc39a4 Rat zinc atom affects expression ISO RGD:1552511 6480464 Zinc affects the expression of SLC39A4 mRNA CTD PMID:16682017 Slc39a4 Rat zinc atom increases uptake ISO RGD:1315470 6480464 SLC39A4 protein results in increased uptake of Zinc CTD PMID:17202136 Slc39a4 Rat zinc atom increases transport ISO RGD:1315470 6480464 SLC39A4 protein results in increased transport of Zinc CTD PMID:18326752 Slc39a4 Rat zinc dichloride multiple interactions ISO RGD:1315470 6480464 zinc chloride inhibits the reaction [Grape Seed Proanthocyanidins results in increased expression of SLC39A4 mRNA] CTD PMID:20471814 Slc39a4 Rat zinc dichloride multiple interactions EXP 6480464 zinc chloride inhibits the reaction [Cadmium Chloride results in increased expression of SLC39A4 mRNA] CTD PMID:25653005 Slc39a4 Rat zinc dichloride decreases expression ISO RGD:1315470 6480464 zinc chloride results in decreased expression of SLC39A4 mRNA CTD PMID:20471814 Slc39a4 Rat zinc(0) multiple interactions ISO RGD:1315470 6480464 Ammonium Chloride inhibits the reaction [Zinc results in increased degradation of SLC39A4 protein]; benzyloxycarbonylleucyl-leucyl-leucine aldehyde more ... CTD PMID:17202136 Slc39a4 Rat zinc(0) increases transport ISO RGD:1315470 6480464 SLC39A4 protein results in increased transport of Zinc CTD PMID:18326752 Slc39a4 Rat zinc(0) increases uptake ISO RGD:1315470 6480464 SLC39A4 protein results in increased uptake of Zinc CTD PMID:17202136 Slc39a4 Rat zinc(0) affects expression ISO RGD:1552511 6480464 Zinc affects the expression of SLC39A4 mRNA CTD PMID:16682017 Slc39a4 Rat zinc(0) decreases expression ISO RGD:1552511 6480464 Zinc deficiency results in decreased expression of SLC39A4 mRNA; Zinc results in decreased expression of more ... CTD PMID:12514265|PMID:12801924|PMID:17202136|PMID:18020946 Slc39a4 Rat zinc(0) increases response to substance ISO RGD:1552511 6480464 SLC39A4 gene mutant form results in increased susceptibility to Zinc deficiency CTD PMID:17483098 Slc39a4 Rat zinc(0) affects expression ISO RGD:1315470 6480464 Zinc affects the expression of SLC39A4 protein CTD PMID:20479680 Slc39a4 Rat zinc(0) multiple interactions ISO RGD:1552511 6480464 Cycloheximide inhibits the reaction [Zinc deficiency results in increased expression of SLC39A4 mRNA]; Cycloheximide inhibits more ... CTD PMID:12801924|PMID:18020946 Slc39a4 Rat zinc(0) decreases expression ISO RGD:1315470 6480464 Zinc results in decreased expression of SLC39A4 mRNA; Zinc results in decreased expression of SLC39A4 more ... CTD PMID:15753530|PMID:17202136 Slc39a4 Rat zinc(0) increases uptake ISO RGD:1552511 6480464 SLC39A4 protein results in increased uptake of Zinc CTD PMID:12801924|PMID:14709598|PMID:15322118 Slc39a4 Rat zinc(0) affects localization ISO RGD:1552511 6480464 Zinc affects the localization of SLC39A4 protein; Zinc deficiency affects the localization of SLC39A4 protein CTD PMID:12801924|PMID:14709598|PMID:15358787 Slc39a4 Rat zinc(0) increases expression ISO RGD:1552511 6480464 Zinc deficiency results in increased expression of SLC39A4 mRNA; Zinc deficiency results in increased expression more ... CTD PMID:12801924|PMID:15358787|PMID:18020946
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 4-nitrophenol (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (ISO) actinomycin D (ISO) ammonium chloride (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) cadmium dichloride (EXP) calcitriol (ISO) cannabidiol (ISO) carbon nanotube (ISO) cefaloridine (EXP) cisplatin (ISO) cobalt dichloride (ISO) coumestrol (ISO) cycloheximide (ISO) cyclosporin A (ISO) DDE (ISO) dextran sulfate (ISO) dibutyl phthalate (EXP) diethylstilbestrol (ISO) dioxygen (ISO) epoxiconazole (ISO) ethyl methanesulfonate (ISO) folic acid (ISO) formaldehyde (ISO) furan (EXP) genistein (ISO) GSK-J4 (ISO) hydrogen peroxide (ISO) indole-3-methanol (EXP) inulin (ISO) irinotecan (EXP) lead diacetate (EXP) leflunomide (EXP) Licochalcone B (ISO) methimazole (EXP) methyl beta-cyclodextrin (ISO) methyl methanesulfonate (ISO) N(4)-hydroxycytidine (ISO) N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-nitrosodiethylamine (ISO) nickel dichloride (EXP) nimesulide (EXP) nitrates (ISO) okadaic acid (ISO) oxycodone (EXP) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (EXP,ISO) pirinixic acid (ISO) progesterone (ISO) propiconazole (ISO) quercetin (ISO) rotenone (EXP,ISO) silver atom (ISO) silver(0) (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sucrose (ISO) tetrachloromethane (ISO) thiram (ISO) titanium dioxide (ISO) trichloroethene (EXP) triphenyl phosphate (EXP) triptonide (ISO) trovafloxacin (ISO) valproic acid (EXP,ISO) vinclozolin (EXP) zinc atom (ISO) zinc dichloride (EXP,ISO) zinc(0) (ISO)
Molecular Function
identical protein binding (IEA,ISO,ISS) metal ion binding (IEA,ISO) metal ion transmembrane transporter activity (IEA) monoatomic cation:bicarbonate symporter activity (IBA) zinc ion binding (IEA,ISO) zinc ion sensor activity (IEA,ISO,ISS) zinc ion sequestering activity (IEA,ISO) zinc ion transmembrane transporter activity (IBA,IEA,ISO,ISS)
Slc39a4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 110,214,017 - 110,218,202 (-) NCBI GRCr8 mRatBN7.2 7 108,333,368 - 108,337,553 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 108,333,381 - 108,337,553 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 110,075,214 - 110,079,418 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 112,298,788 - 112,302,992 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 112,259,628 - 112,263,832 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 117,675,718 - 117,682,586 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 117,675,720 - 117,680,004 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 117,663,813 - 117,667,986 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 114,661,925 - 114,666,098 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 114,696,147 - 114,700,327 (-) NCBI Celera 7 104,683,583 - 104,687,756 (-) NCBI Celera Cytogenetic Map 7 q34 NCBI
SLC39A4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 144,412,414 - 144,416,844 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 144,409,742 - 144,416,844 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 145,637,798 - 145,642,228 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 145,608,606 - 145,613,081 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 8 145,608,606 - 145,613,081 NCBI Celera 8 141,812,232 - 141,816,707 (-) NCBI Celera Cytogenetic Map 8 q24.3 NCBI HuRef 8 140,751,031 - 140,755,512 (-) NCBI HuRef CHM1_1 8 145,676,089 - 145,680,570 (-) NCBI CHM1_1 T2T-CHM13v2.0 8 145,582,227 - 145,586,657 (-) NCBI T2T-CHM13v2.0
Slc39a4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 76,496,583 - 76,501,579 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 76,496,583 - 76,501,584 (-) Ensembl GRCm39 Ensembl GRCm38 15 76,612,383 - 76,618,506 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 76,612,383 - 76,617,384 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 76,442,813 - 76,447,282 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 76,439,638 - 76,444,107 (-) NCBI MGSCv36 mm8 Celera 15 78,105,998 - 78,110,467 (-) NCBI Celera Cytogenetic Map 15 D3 NCBI cM Map 15 36.16 NCBI
Slc39a4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955454 3,040,877 - 3,046,250 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955454 3,041,316 - 3,047,419 (-) NCBI ChiLan1.0 ChiLan1.0
SLC39A4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 7 161,903,143 - 161,908,026 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 8 137,432,188 - 137,437,027 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 8 141,178,792 - 141,183,565 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 8 144,169,089 - 144,173,517 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 8 144,169,089 - 144,173,517 (-) Ensembl panpan1.1 panPan2
SLC39A4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 13 37,833,073 - 37,838,304 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 13 37,833,156 - 37,838,522 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 13 37,794,803 - 37,799,894 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 13 38,307,751 - 38,312,842 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 13 38,308,739 - 38,312,970 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 13 37,999,570 - 38,004,661 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 13 38,108,215 - 38,113,309 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 13 38,584,583 - 38,589,678 (-) NCBI UU_Cfam_GSD_1.0
Slc39a4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 411,386 - 416,321 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936470 7,838,030 - 7,842,262 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936470 7,836,612 - 7,842,262 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SLC39A4
SLC39A4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 8 138,622,100 - 138,626,749 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 8 138,622,224 - 138,626,376 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666039 1,229,126 - 1,234,212 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Slc39a4
.
Predicted Target Of
Count of predictions: 413 Count of miRNA genes: 193 Interacting mature miRNAs: 216 Transcripts: ENSRNOT00000040422, ENSRNOT00000071522 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 1331728 Bp214 Blood pressure QTL 214 2.825 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 80221299 124373579 Rat 1331731 Bp216 Blood pressure QTL 216 2.851 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 102297359 133492884 Rat 2298475 Eau6 Experimental allergic uveoretinitis QTL 6 0.0029 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 7 84257275 129257275 Rat 71114 Niddm14 Non-insulin dependent diabetes mellitus QTL 14 4.5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 7 84257275 129257275 Rat 1357336 Gluco6 Glucose level QTL 6 3.4 blood glucose amount (VT:0000188) serum glucose level (CMO:0000543) 7 94811326 116294265 Rat 1358361 Sradr5 Stress Responsive Adrenal Weight QTL 5 5.55 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 7 43747012 108555253 Rat 1357338 Stl17 Serum triglyceride level QTL 17 3.23 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 69736356 112729554 Rat 631687 Hcas1 Hepatocarcinoma susceptibility QTL 1 3.9 0.001 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 7 91412594 129807172 Rat 70159 Bp61 Blood pressure QTL 61 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 103146217 116738842 Rat 634331 Pia17 Pristane induced arthritis QTL 17 4.7 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 7 73829340 130221005 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 634322 Bw12 Body weight QTL 12 0 body mass (VT:0001259) body weight (CMO:0000012) 7 83153392 128153392 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 1549899 Stresp8 Stress response QTL 8 4.37 0.0008 stress-related behavior trait (VT:0010451) defensive burying duration (CMO:0001961) 7 90482196 135012528 Rat 2317052 Aia17 Adjuvant induced arthritis QTL 17 2.13 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 7 81737938 126737938 Rat 631529 Tls2 T-lymphoma susceptibility QTL 2 0 0.001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 7 80221299 109401111 Rat 731176 Glom5 Glomerulus QTL 5 2.5 0.0035 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 7 96670164 135012528 Rat 7411607 Foco15 Food consumption QTL 15 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2306821 Bp335 Blood pressure QTL 335 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 106571501 135012528 Rat 1558655 Swd4 Spike wave discharge measurement QTL 4 3.68 0.0002 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge severity grade (CMO:0001988) 7 86983365 131983365 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 1331768 Kidm10 Kidney mass QTL 10 4.62096 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 80221299 125221299 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 2313102 Bmd79 Bone mineral density QTL 79 2.3 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 7 94811085 116738842 Rat 731174 Uae23 Urinary albumin excretion QTL 23 2.4 0.0042 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 7 104603555 135012528 Rat 2316947 Rf58 Renal function QTL 58 7.8 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 7 68938720 113886318 Rat 1331746 Kidm9 Kidney mass QTL 9 3.934 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 7 80221299 112308525 Rat 7411654 Foco25 Food consumption QTL 25 9.3 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2316955 Stl24 Serum triglyceride level QTL 24 7.1 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 7 68938720 113886318 Rat 2299163 Iddm34 Insulin dependent diabetes mellitus QTL 34 2.71 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 7 91281130 135012528 Rat 2316952 Pur22 Proteinuria QTL 22 5.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 7 68938720 113886318 Rat 631540 Bw9 Body weight QTL 9 4.5 body mass (VT:0001259) body weight (CMO:0000012) 7 69736226 117455174 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
AU041686
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 7 110,214,194 - 110,214,493 (+) Marker Load Pipeline mRatBN7.2 7 108,333,545 - 108,333,844 (+) MAPPER mRatBN7.2 Rnor_6.0 7 117,675,896 - 117,676,194 NCBI Rnor6.0 Rnor_5.0 7 117,663,979 - 117,664,277 UniSTS Rnor5.0 RGSC_v3.4 7 114,662,091 - 114,662,389 UniSTS RGSC3.4 Celera 7 104,683,749 - 104,684,047 UniSTS Cytogenetic Map 7 q34 UniSTS
RH131800
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 108,333,376 - 108,333,556 (+) MAPPER mRatBN7.2 Rnor_6.0 7 117,675,727 - 117,675,906 NCBI Rnor6.0 Rnor_5.0 7 117,663,810 - 117,663,989 UniSTS Rnor5.0 RGSC_v3.4 7 114,661,922 - 114,662,101 UniSTS RGSC3.4 Celera 7 104,683,580 - 104,683,759 UniSTS RH 3.4 Map 7 795.3 UniSTS Cytogenetic Map 7 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
10
44
113
91
90
59
25
59
6
212
91
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000040422 ⟹ ENSRNOP00000047376
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 108,333,381 - 108,337,553 (-) Ensembl Rnor_6.0 Ensembl 7 117,675,720 - 117,680,004 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000071522 ⟹ ENSRNOP00000066561
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 108,333,381 - 108,337,553 (-) Ensembl Rnor_6.0 Ensembl 7 117,676,948 - 117,679,219 (-) Ensembl
RefSeq Acc Id:
NM_001077669 ⟹ NP_001071137
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 110,214,017 - 110,218,202 (-) NCBI mRatBN7.2 7 108,333,368 - 108,337,553 (-) NCBI Rnor_6.0 7 117,675,730 - 117,679,903 (-) NCBI Rnor_5.0 7 117,663,813 - 117,667,986 (-) NCBI RGSC_v3.4 7 114,661,925 - 114,666,098 (-) RGD Celera 7 104,683,583 - 104,687,756 (-) RGD
Sequence:
CCCAGCTCCAGTCTGGCCCCAGGCAGTCCCAGCAGTCTCCTGCTAGCCCAGAAGCCAGCACCACTGCAGGGAACACTTTGGGAGCGTGAGGCATGATGCTCCCAAAGTCGCTCACACAGGGGCTCTTG
hide sequence
RefSeq Acc Id:
NP_001071137 ⟸ NM_001077669
- Peptide Label:
precursor
- UniProtKB:
A0JPN2 (UniProtKB/Swiss-Prot), A0A0H2UHY4 (UniProtKB/TrEMBL), A6HSB3 (UniProtKB/TrEMBL), M0RAL0 (UniProtKB/TrEMBL)
- Sequence:
MLPKSLTQGLLLAMLVGTAAMVQPYHLLSLLTSGQGALDRTALDGLLNTLVARVHCTDGPCEKCLSVETALALGKPDKPQLAPESVLESRYITYLSAAAALYLNDPEKTCKDIRAGLLASHVDDYLAK
hide sequence
Ensembl Acc Id:
ENSRNOP00000066561 ⟸ ENSRNOT00000071522
Ensembl Acc Id:
ENSRNOP00000047376 ⟸ ENSRNOT00000040422
RGD ID: 13695430 Promoter ID: EPDNEW_R5953 Type: multiple initiation site Name: Slc39a4_1 Description: solute carrier family 39 member 4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 117,679,894 - 117,679,954 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-09
Slc39a4
solute carrier family 39 member 4
Slc39a4
solute carrier family 39 (zinc transporter), member 4
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Slc39a4
solute carrier family 39 (zinc transporter), member 4
Slc39a4_predicted
solute carrier family 39 (zinc transporter), member 4 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Slc39a4_predicted
solute carrier family 39 (zinc transporter), member 4 (predicted)
Symbol and Name status set to approved
70820 APPROVED
