Symbol:
Smoc2
Name:
SPARC related modular calcium binding 2
RGD ID:
1306681
Description:
Predicted to enable calcium ion binding activity; extracellular matrix binding activity; and heparin binding activity. Predicted to be involved in several processes, including positive regulation of endothelial cell chemotaxis; positive regulation of signal transduction; and positive regulation of vascular wound healing. Predicted to act upstream of or within positive regulation of cell-substrate adhesion. Predicted to be located in interstitial matrix. Predicted to be active in basement membrane and extracellular space. Orthologous to human SMOC2 (SPARC related modular calcium binding 2); INTERACTS WITH 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane; 1,2-dimethylhydrazine; 1-naphthyl isothiocyanate.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC292401; SPARC-related modular calcium-binding protein 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 63,935,627 - 64,064,952 (+) NCBI GRCr8 mRatBN7.2 1 55,262,472 - 55,391,804 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 55,262,530 - 55,391,693 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 60,133,640 - 60,262,572 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 68,790,717 - 68,919,413 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 62,043,596 - 62,172,525 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 56,242,289 - 56,374,106 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 56,242,346 - 56,374,120 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 57,434,118 - 57,565,436 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 53,165,792 - 53,295,145 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 53,168,675 - 53,298,175 (+) NCBI Celera 1 51,480,576 - 51,609,313 (+) NCBI Celera Cytogenetic Map 1 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Smoc2 Rat (1->4)-beta-D-glucan multiple interactions ISO Smoc2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of SMOC2 mRNA CTD PMID:36331819 Smoc2 Rat 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane multiple interactions EXP 6480464 2 more ... CTD PMID:19414516 Smoc2 Rat 1,2-dichloroethane decreases expression ISO Smoc2 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of SMOC2 mRNA CTD PMID:28960355 Smoc2 Rat 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of SMOC2 mRNA CTD PMID:27840820 Smoc2 Rat 1,2-dimethylhydrazine increases expression ISO Smoc2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of SMOC2 mRNA CTD PMID:22206623 Smoc2 Rat 1,2-dimethylhydrazine multiple interactions ISO Smoc2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of SMOC2 mRNA CTD PMID:22206623 Smoc2 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of SMOC2 mRNA CTD PMID:25380136 Smoc2 Rat 17beta-estradiol increases expression ISO SMOC2 (Homo sapiens) 6480464 Estradiol results in increased expression of SMOC2 mRNA CTD PMID:24758408 and PMID:31614463 Smoc2 Rat 17beta-estradiol increases expression ISO Smoc2 (Mus musculus) 6480464 Estradiol results in increased expression of SMOC2 mRNA CTD PMID:39298647 Smoc2 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of SMOC2 mRNA CTD PMID:32145629 Smoc2 Rat 17beta-estradiol multiple interactions ISO SMOC2 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of SMOC2 mRNA more ... CTD PMID:20660070 more ... Smoc2 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:27291303 Smoc2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Smoc2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of SMOC2 mRNA CTD PMID:19146932 Smoc2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO SMOC2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of SMOC2 mRNA CTD PMID:36370075 Smoc2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SMOC2 mRNA CTD PMID:34747641 Smoc2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SMOC2 mRNA CTD PMID:32109520 Smoc2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Smoc2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SMOC2 mRNA CTD PMID:26377647 Smoc2 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Smoc2 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Smoc2 Rat 3',5'-cyclic AMP multiple interactions EXP 6480464 2 more ... CTD PMID:19414516 Smoc2 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Smoc2 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of SMOC2 mRNA CTD PMID:20188158 Smoc2 Rat 3,7-dihydropurine-6-thione decreases expression EXP 6480464 Mercaptopurine results in decreased expression of SMOC2 mRNA CTD PMID:23358152 Smoc2 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO SMOC2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of SMOC2 mRNA more ... CTD PMID:28628672 Smoc2 Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of SMOC2 mRNA CTD PMID:25380136 Smoc2 Rat 4,4'-sulfonyldiphenol multiple interactions ISO SMOC2 (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in decreased methylation of SMOC2 gene and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of SMOC2 mRNA CTD PMID:28628672 and PMID:31601247 Smoc2 Rat 4,4'-sulfonyldiphenol decreases methylation ISO SMOC2 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of SMOC2 gene CTD PMID:31601247 Smoc2 Rat 4,4'-sulfonyldiphenol affects expression ISO Smoc2 (Mus musculus) 6480464 bisphenol S affects the expression of SMOC2 mRNA CTD PMID:39298647 Smoc2 Rat 4,4'-sulfonyldiphenol multiple interactions ISO Smoc2 (Mus musculus) 6480464 [bisphenol S co-treated with Tretinoin] results in decreased expression of SMOC2 mRNA CTD PMID:30951980 Smoc2 Rat 4,4'-sulfonyldiphenol increases expression ISO Smoc2 (Mus musculus) 6480464 bisphenol S results in increased expression of SMOC2 mRNA CTD PMID:30951980 Smoc2 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of SMOC2 mRNA CTD PMID:24780913 and PMID:30047161 Smoc2 Rat acrylamide affects expression EXP 6480464 Acrylamide affects the expression of SMOC2 mRNA CTD PMID:28959563 Smoc2 Rat aflatoxin B1 decreases expression ISO Smoc2 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of SMOC2 mRNA CTD PMID:19770486 Smoc2 Rat aflatoxin B1 increases methylation ISO SMOC2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of SMOC2 intron CTD PMID:30157460 Smoc2 Rat Aflatoxin B2 alpha affects methylation ISO SMOC2 (Homo sapiens) 6480464 aflatoxin B2 affects the methylation of SMOC2 intron CTD PMID:30157460 Smoc2 Rat all-trans-retinoic acid increases expression ISO SMOC2 (Homo sapiens) 6480464 Tretinoin results in increased expression of SMOC2 mRNA CTD PMID:21934132 Smoc2 Rat all-trans-retinoic acid multiple interactions ISO Smoc2 (Mus musculus) 6480464 [bisphenol A co-treated with Tretinoin] results in decreased expression of SMOC2 mRNA more ... CTD PMID:30951980 Smoc2 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of SMOC2 mRNA CTD PMID:35163327 Smoc2 Rat antirheumatic drug increases expression ISO SMOC2 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of SMOC2 mRNA CTD PMID:24449571 Smoc2 Rat benzo[a]pyrene increases expression ISO SMOC2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of SMOC2 mRNA CTD PMID:22316170 Smoc2 Rat benzo[a]pyrene increases methylation ISO SMOC2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of SMOC2 5' UTR CTD PMID:27901495 Smoc2 Rat benzo[a]pyrene affects methylation ISO SMOC2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of SMOC2 intron and Benzo(a)pyrene affects the methylation of SMOC2 promoter CTD PMID:27901495 and PMID:30157460 Smoc2 Rat benzo[a]pyrene decreases methylation ISO SMOC2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of SMOC2 3' UTR CTD PMID:27901495 Smoc2 Rat benzo[a]pyrene decreases expression ISO Smoc2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of SMOC2 mRNA CTD PMID:19146932 Smoc2 Rat benzo[a]pyrene increases expression ISO Smoc2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of SMOC2 mRNA CTD PMID:21964900 Smoc2 Rat benzo[e]pyrene increases methylation ISO SMOC2 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of SMOC2 intron CTD PMID:30157460 Smoc2 Rat beta-lapachone decreases expression ISO SMOC2 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of SMOC2 mRNA CTD PMID:38218311 Smoc2 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO SMOC2 (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of SMOC2 gene CTD PMID:33872906 Smoc2 Rat bisphenol A increases expression ISO Smoc2 (Mus musculus) 6480464 bisphenol A results in increased expression of SMOC2 mRNA CTD PMID:23798566 and PMID:30951980 Smoc2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SMOC2 mRNA CTD PMID:34947998 Smoc2 Rat bisphenol A multiple interactions ISO Smoc2 (Mus musculus) 6480464 [bisphenol A co-treated with Tretinoin] results in decreased expression of SMOC2 mRNA CTD PMID:30951980 Smoc2 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of SMOC2 gene CTD PMID:28505145 Smoc2 Rat bisphenol A multiple interactions ISO SMOC2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of SMOC2 mRNA CTD PMID:28628672 Smoc2 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of SMOC2 mRNA CTD PMID:25181051 Smoc2 Rat bisphenol F multiple interactions ISO SMOC2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of SMOC2 mRNA CTD PMID:28628672 Smoc2 Rat bisphenol F decreases expression ISO Smoc2 (Mus musculus) 6480464 bisphenol F results in decreased expression of SMOC2 mRNA CTD PMID:36706583 Smoc2 Rat bisphenol F multiple interactions ISO Smoc2 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of SMOC2 mRNA CTD PMID:30951980 Smoc2 Rat bisphenol F increases expression ISO Smoc2 (Mus musculus) 6480464 bisphenol F results in increased expression of SMOC2 mRNA CTD PMID:30951980 and PMID:38685157 Smoc2 Rat cadmium dichloride increases expression ISO SMOC2 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of SMOC2 mRNA CTD PMID:38568856 Smoc2 Rat cantharidin decreases expression ISO Smoc2 (Mus musculus) 6480464 Cantharidin results in decreased expression of SMOC2 mRNA CTD PMID:36907384 Smoc2 Rat carbon nanotube affects expression ISO Smoc2 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Smoc2 Rat carbon nanotube decreases expression ISO Smoc2 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Smoc2 Rat CGP 52608 multiple interactions ISO SMOC2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to SMOC2 gene] CTD PMID:28238834 Smoc2 Rat choline multiple interactions ISO Smoc2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of SMOC2 mRNA CTD PMID:20938992 Smoc2 Rat chrysene increases expression ISO Smoc2 (Mus musculus) 6480464 chrysene results in increased expression of SMOC2 mRNA CTD PMID:26377693 Smoc2 Rat cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of SMOC2 mRNA CTD PMID:24880025 Smoc2 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of SMOC2 mRNA CTD PMID:30556269 Smoc2 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of SMOC2 mRNA CTD PMID:30556269 Smoc2 Rat copper(II) sulfate increases expression ISO SMOC2 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of SMOC2 mRNA CTD PMID:19549813 Smoc2 Rat cyclosporin A increases expression ISO Smoc2 (Mus musculus) 6480464 Cyclosporine results in increased expression of SMOC2 mRNA CTD PMID:19770486 Smoc2 Rat cytarabine decreases expression ISO SMOC2 (Homo sapiens) 6480464 Cytarabine results in decreased expression of SMOC2 mRNA CTD PMID:21198554 Smoc2 Rat dexamethasone increases expression ISO SMOC2 (Homo sapiens) 6480464 Dexamethasone results in increased expression of SMOC2 mRNA CTD PMID:25047013 Smoc2 Rat dexamethasone multiple interactions ISO SMOC2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of SMOC2 mRNA more ... CTD PMID:28628672 Smoc2 Rat dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of SMOC2 mRNA CTD PMID:20032058 Smoc2 Rat dexamethasone multiple interactions EXP 6480464 Testosterone inhibits the reaction [Dexamethasone results in decreased expression of SMOC2 mRNA] CTD PMID:20032058 Smoc2 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of SMOC2 mRNA CTD PMID:21266533 Smoc2 Rat dorsomorphin multiple interactions ISO SMOC2 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Smoc2 Rat doxorubicin decreases expression ISO SMOC2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of SMOC2 mRNA CTD PMID:29803840 Smoc2 Rat entinostat increases expression ISO SMOC2 (Homo sapiens) 6480464 entinostat results in increased expression of SMOC2 mRNA CTD PMID:26272509 Smoc2 Rat entinostat multiple interactions ISO SMOC2 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SMOC2 mRNA CTD PMID:27188386 Smoc2 Rat ethanol decreases expression ISO Smoc2 (Mus musculus) 6480464 Ethanol results in decreased expression of SMOC2 mRNA CTD PMID:19167417 Smoc2 Rat flurbiprofen decreases expression ISO Smoc2 (Mus musculus) 6480464 Flurbiprofen results in decreased expression of SMOC2 mRNA CTD PMID:16949054 Smoc2 Rat folic acid multiple interactions ISO Smoc2 (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Smoc2 Rat formaldehyde increases expression ISO SMOC2 (Homo sapiens) 6480464 Formaldehyde results in increased expression of SMOC2 mRNA CTD PMID:27664576 Smoc2 Rat fulvestrant multiple interactions ISO SMOC2 (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in decreased methylation of SMOC2 gene CTD PMID:31601247 Smoc2 Rat furan increases expression ISO Smoc2 (Mus musculus) 6480464 furan results in increased expression of SMOC2 mRNA CTD PMID:24183702 Smoc2 Rat furan increases expression EXP 6480464 furan results in increased expression of SMOC2 mRNA CTD PMID:27387713 Smoc2 Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of SMOC2 mRNA CTD PMID:24136188 Smoc2 Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of SMOC2 mRNA CTD PMID:24915197 Smoc2 Rat hydrogen peroxide affects expression ISO SMOC2 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of SMOC2 mRNA CTD PMID:20044591 Smoc2 Rat indometacin multiple interactions ISO SMOC2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of SMOC2 mRNA more ... CTD PMID:28628672 Smoc2 Rat inulin multiple interactions ISO Smoc2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of SMOC2 mRNA CTD PMID:36331819 Smoc2 Rat isoprenaline decreases expression ISO Smoc2 (Mus musculus) 6480464 Isoproterenol results in decreased expression of SMOC2 mRNA CTD PMID:20003209 Smoc2 Rat ketamine decreases expression EXP 6480464 Ketamine results in decreased expression of SMOC2 mRNA CTD PMID:20080153 Smoc2 Rat L-methionine multiple interactions ISO Smoc2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of SMOC2 mRNA CTD PMID:20938992 Smoc2 Rat maneb multiple interactions ISO Smoc2 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of SMOC2 mRNA CTD PMID:36117858 Smoc2 Rat menadione affects expression ISO SMOC2 (Homo sapiens) 6480464 Vitamin K 3 affects the expression of SMOC2 mRNA CTD PMID:20044591 Smoc2 Rat mercaptopurine decreases expression EXP 6480464 Mercaptopurine results in decreased expression of SMOC2 mRNA CTD PMID:23358152 Smoc2 Rat mercury dibromide increases expression ISO SMOC2 (Homo sapiens) 6480464 mercuric bromide results in increased expression of SMOC2 mRNA CTD PMID:26272509 Smoc2 Rat mercury dibromide multiple interactions ISO SMOC2 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SMOC2 mRNA CTD PMID:27188386 Smoc2 Rat methamphetamine decreases expression ISO Smoc2 (Mus musculus) 6480464 Methamphetamine results in decreased expression of SMOC2 mRNA CTD PMID:36914120 Smoc2 Rat methapyrilene increases methylation ISO SMOC2 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of SMOC2 intron CTD PMID:30157460 Smoc2 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of SMOC2 gene CTD PMID:35440735 Smoc2 Rat microcystin-LR increases expression ISO Smoc2 (Mus musculus) 6480464 cyanoginosin LR results in increased expression of SMOC2 mRNA CTD PMID:17654400 Smoc2 Rat microcystin-LR increases expression EXP 6480464 cyanoginosin LR results in increased expression of SMOC2 mRNA CTD PMID:34740672 Smoc2 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO SMOC2 (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of SMOC2 gene CTD PMID:33872906 Smoc2 Rat N-nitrosodiethylamine increases expression ISO Smoc2 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of SMOC2 mRNA CTD PMID:17854601 and PMID:24535843 Smoc2 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of SMOC2 mRNA CTD PMID:28943392 Smoc2 Rat N-nitrosodiethylamine multiple interactions ISO Smoc2 (Mus musculus) 6480464 RB1 protein inhibits the reaction [Diethylnitrosamine results in increased expression of SMOC2 mRNA] CTD PMID:17854601 Smoc2 Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of SMOC2 mRNA CTD PMID:25380136 Smoc2 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of SMOC2 mRNA CTD PMID:25729387 Smoc2 Rat panobinostat multiple interactions ISO SMOC2 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SMOC2 mRNA CTD PMID:27188386 Smoc2 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of SMOC2 mRNA CTD PMID:32680482 Smoc2 Rat paraquat multiple interactions ISO Smoc2 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of SMOC2 mRNA CTD PMID:36117858 Smoc2 Rat perfluorohexanesulfonic acid increases expression ISO Smoc2 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of SMOC2 mRNA CTD PMID:37995155 Smoc2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Smoc2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of SMOC2 mRNA more ... CTD PMID:36331819 Smoc2 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of SMOC2 mRNA CTD PMID:35163327 Smoc2 Rat phenylephrine decreases expression EXP 6480464 Phenylephrine results in decreased expression of SMOC2 mRNA CTD PMID:18158353 Smoc2 Rat phenylmercury acetate increases expression ISO SMOC2 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of SMOC2 mRNA CTD PMID:26272509 Smoc2 Rat phenylmercury acetate multiple interactions ISO SMOC2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SMOC2 mRNA CTD PMID:27188386 Smoc2 Rat pirinixic acid decreases expression ISO Smoc2 (Mus musculus) 6480464 pirinixic acid results in decreased expression of SMOC2 mRNA CTD PMID:23811191 Smoc2 Rat pregnenolone 16alpha-carbonitrile increases expression ISO Smoc2 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in increased expression of SMOC2 mRNA CTD PMID:22698814 Smoc2 Rat progesterone multiple interactions ISO SMOC2 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of SMOC2 mRNA CTD PMID:20660070 Smoc2 Rat progesterone increases expression ISO Smoc2 (Mus musculus) 6480464 Progesterone results in increased expression of SMOC2 mRNA CTD PMID:22238285 Smoc2 Rat progesterone affects expression ISO Smoc2 (Mus musculus) 6480464 Progesterone affects the expression of SMOC2 mRNA CTD PMID:17251523 Smoc2 Rat purine-6-thiol decreases expression EXP 6480464 Mercaptopurine results in decreased expression of SMOC2 mRNA CTD PMID:23358152 Smoc2 Rat pyridaben increases expression ISO Smoc2 (Mus musculus) 6480464 pyridaben results in increased expression of SMOC2 mRNA CTD PMID:22563483 Smoc2 Rat SB 431542 multiple interactions ISO SMOC2 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Smoc2 Rat silicon dioxide decreases expression ISO SMOC2 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of SMOC2 mRNA CTD PMID:25895662 Smoc2 Rat sodium arsenite affects methylation ISO SMOC2 (Homo sapiens) 6480464 sodium arsenite affects the methylation of SMOC2 gene CTD PMID:28589171 Smoc2 Rat sodium arsenite decreases expression ISO Smoc2 (Mus musculus) 6480464 sodium arsenite results in decreased expression of SMOC2 mRNA CTD PMID:37682722 Smoc2 Rat sodium arsenite increases expression ISO SMOC2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of SMOC2 mRNA CTD PMID:34032870 and PMID:38568856 Smoc2 Rat sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of SMOC2 mRNA CTD PMID:22561333 Smoc2 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of SMOC2 mRNA CTD PMID:22561333 and PMID:25993096 Smoc2 Rat sodium fluoride decreases expression EXP 6480464 Sodium Fluoride results in decreased expression of SMOC2 mRNA CTD PMID:27257137 Smoc2 Rat sotorasib multiple interactions ISO SMOC2 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of SMOC2 mRNA CTD PMID:36139627 Smoc2 Rat testosterone multiple interactions EXP 6480464 Testosterone inhibits the reaction [Dexamethasone results in decreased expression of SMOC2 mRNA] CTD PMID:20032058 Smoc2 Rat tetrachloromethane increases expression ISO Smoc2 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of SMOC2 mRNA CTD PMID:27339419 and PMID:31919559 Smoc2 Rat tetrachloromethane affects expression ISO Smoc2 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of SMOC2 mRNA CTD PMID:17484886 Smoc2 Rat thioacetamide multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of SMOC2 mRNA CTD PMID:28943392 Smoc2 Rat titanium dioxide decreases methylation ISO Smoc2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of SMOC2 gene and titanium dioxide results in decreased methylation of SMOC2 promoter CTD PMID:35295148 Smoc2 Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of SMOC2 mRNA CTD PMID:25729387 Smoc2 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of SMOC2 mRNA CTD PMID:25729387 Smoc2 Rat trametinib multiple interactions ISO SMOC2 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of SMOC2 mRNA CTD PMID:36139627 Smoc2 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of SMOC2 mRNA CTD PMID:33387578 Smoc2 Rat trichostatin A increases expression ISO SMOC2 (Homo sapiens) 6480464 trichostatin A results in increased expression of SMOC2 mRNA CTD PMID:24935251 Smoc2 Rat valproic acid increases methylation ISO SMOC2 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of SMOC2 gene CTD PMID:29154799 Smoc2 Rat valproic acid affects expression ISO SMOC2 (Homo sapiens) 6480464 Valproic Acid affects the expression of SMOC2 mRNA CTD PMID:25979313 Smoc2 Rat valproic acid increases expression ISO Smoc2 (Mus musculus) 6480464 Valproic Acid results in increased expression of SMOC2 mRNA CTD PMID:24896083 Smoc2 Rat valproic acid increases expression ISO SMOC2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of SMOC2 mRNA CTD PMID:23179753 more ... Smoc2 Rat valproic acid multiple interactions ISO SMOC2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SMOC2 mRNA CTD PMID:27188386 Smoc2 Rat vorinostat decreases expression ISO SMOC2 (Homo sapiens) 6480464 vorinostat results in decreased expression of SMOC2 mRNA CTD PMID:27188386 Smoc2 Rat zoledronic acid increases expression ISO SMOC2 (Homo sapiens) 6480464 zoledronic acid results in increased expression of SMOC2 mRNA CTD PMID:24714768
(1->4)-beta-D-glucan (ISO) 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (EXP) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (EXP,ISO) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3',5'-cyclic AMP (EXP) 3,4-methylenedioxymethamphetamine (ISO) 3,7-dihydropurine-6-thione (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) antirheumatic drug (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium dichloride (ISO) cantharidin (ISO) carbon nanotube (ISO) CGP 52608 (ISO) choline (ISO) chrysene (ISO) cisplatin (EXP) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (ISO) cyclosporin A (ISO) cytarabine (ISO) dexamethasone (EXP,ISO) dibutyl phthalate (EXP) dorsomorphin (ISO) doxorubicin (ISO) entinostat (ISO) ethanol (ISO) flurbiprofen (ISO) folic acid (ISO) formaldehyde (ISO) fulvestrant (ISO) furan (EXP,ISO) glafenine (EXP) glycidol (EXP) hydrogen peroxide (ISO) indometacin (ISO) inulin (ISO) isoprenaline (ISO) ketamine (EXP) L-methionine (ISO) maneb (ISO) menadione (ISO) mercaptopurine (EXP) mercury dibromide (ISO) methamphetamine (ISO) methapyrilene (ISO) methoxychlor (EXP) microcystin-LR (EXP,ISO) mono(2-ethylhexyl) phthalate (ISO) N-nitrosodiethylamine (EXP,ISO) N-nitrosodimethylamine (EXP) oxaliplatin (EXP) panobinostat (ISO) paraquat (EXP,ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenylephrine (EXP) phenylmercury acetate (ISO) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (ISO) progesterone (ISO) purine-6-thiol (EXP) pyridaben (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium dichromate (EXP) sodium fluoride (EXP) sotorasib (ISO) testosterone (EXP) tetrachloromethane (ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) trametinib (ISO) trichloroethene (EXP) trichostatin A (ISO) valproic acid (ISO) vorinostat (ISO) zoledronic acid (ISO)
Smoc2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 63,935,627 - 64,064,952 (+) NCBI GRCr8 mRatBN7.2 1 55,262,472 - 55,391,804 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 55,262,530 - 55,391,693 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 60,133,640 - 60,262,572 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 68,790,717 - 68,919,413 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 62,043,596 - 62,172,525 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 56,242,289 - 56,374,106 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 56,242,346 - 56,374,120 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 57,434,118 - 57,565,436 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 53,165,792 - 53,295,145 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 53,168,675 - 53,298,175 (+) NCBI Celera 1 51,480,576 - 51,609,313 (+) NCBI Celera Cytogenetic Map 1 q12 NCBI
SMOC2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 168,441,184 - 168,667,992 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 168,441,151 - 168,673,445 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 168,841,864 - 169,068,672 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 168,584,880 - 168,810,596 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 168,660,586 - 168,886,303 NCBI Celera 6 169,559,437 - 169,782,279 (+) NCBI Celera Cytogenetic Map 6 q27 NCBI HuRef 6 166,267,021 - 166,491,991 (+) NCBI HuRef CHM1_1 6 169,103,759 - 169,328,184 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 169,784,308 - 170,014,051 (+) NCBI T2T-CHM13v2.0
Smoc2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 14,499,768 - 14,625,052 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 14,499,768 - 14,625,052 (+) Ensembl GRCm39 Ensembl GRCm38 17 14,279,490 - 14,404,790 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 14,279,506 - 14,404,790 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 14,416,513 - 14,541,797 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 14,016,132 - 14,141,361 (+) NCBI MGSCv36 mm8 Celera 17 15,080,624 - 15,205,897 (+) NCBI Celera Cytogenetic Map 17 A2 NCBI cM Map 17 8.95 NCBI
Smoc2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955411 4,729,706 - 4,822,140 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955411 4,729,753 - 4,822,140 (-) NCBI ChiLan1.0 ChiLan1.0
SMOC2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 188,680,006 - 188,916,951 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 186,561,388 - 186,795,664 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 166,430,178 - 166,664,577 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 171,366,929 - 171,588,320 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 171,366,929 - 171,589,084 (+) Ensembl panpan1.1 panPan2
SMOC2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 55,826,354 - 55,986,053 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 55,825,666 - 55,986,052 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 56,617,795 - 56,777,591 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 56,009,740 - 56,168,234 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 56,009,366 - 56,168,233 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 55,906,584 - 56,065,183 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 55,753,833 - 55,912,398 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 56,380,993 - 56,539,474 (+) NCBI UU_Cfam_GSD_1.0
Smoc2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 150,202,183 - 150,342,912 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936489 17,454,270 - 17,594,901 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936489 17,454,274 - 17,594,894 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SMOC2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 1,193,167 - 1,332,694 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 1,193,163 - 1,332,739 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 2,133,877 - 2,217,364 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SMOC2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 13 96,264,170 - 96,477,393 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 13 96,264,181 - 96,477,491 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 68,107,603 - 68,398,081 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Smoc2
.
Predicted Target Of
Count of predictions: 455 Count of miRNA genes: 245 Interacting mature miRNAs: 301 Transcripts: ENSRNOT00000019317 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331732 Srn4 Serum renin concentration QTL 4 4.467 renin activity (VT:0005581) plasma renin activity level (CMO:0000116) 1 35239598 78430678 Rat 2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1578649 Bmd8 Bone mineral density QTL 8 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 49393172 94393172 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 4889929 Bss87 Bone structure and strength QTL 87 6.7 tibia area (VT:1000281) tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722) 1 53895117 82174945 Rat 1331792 Rf29 Renal function QTL 29 4.589 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 1 35239598 78430678 Rat 2313062 Bmd73 Bone mineral density QTL 73 3.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 11481312 82174945 Rat 8552900 Pigfal1 Plasma insulin-like growth factor 1 level QTL 1 7.4 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 1 34836858 79836858 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 1554320 Bmd1 Bone mineral density QTL 1 12.2 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 509108 86060548 Rat 1354643 Foco2 Food consumption QTL 2 7.17 0.0001 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 1 33449848 78449848 Rat 2302059 Pia36 Pristane induced arthritis QTL 36 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 43333002 88333002 Rat 2313065 Bss67 Bone structure and strength QTL 67 3.1 0.0001 tibia area (VT:1000281) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 1357400 Bw62 Body weight QTL62 4.05 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 1 22340647 67340647 Rat 2313069 Bss68 Bone structure and strength QTL 68 2.9 0.0001 tibia size trait (VT:0100001) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 2313075 Bss66 Bone structure and strength QTL 66 3.4 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 11481312 82174945 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 1300167 Hrtrt2 Heart rate QTL 2 4.35 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 11481312 75088344 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 2313077 Bss69 Bone structure and strength QTL 69 3.5 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 11481312 82174945 Rat 1331778 Rf28 Renal function QTL 28 4.66 urine potassium amount (VT:0010539) urine potassium excretion rate (CMO:0000761) 1 45803140 78430678 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 1578756 Iddm22 Insulin dependent diabetes mellitus QTL 22 2.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 11835181 56835181 Rat 1331785 Rf27 Renal function QTL 27 4.643 urine sodium amount (VT:0006274) urine sodium level (CMO:0000129) 1 28879780 78430678 Rat 1300172 Bp172 Blood pressure QTL 172 3.56 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 32737273 90665040 Rat 4889962 Bss94 Bone structure and strength QTL 94 3.8 tibia area (VT:1000281) tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722) 1 49361465 82174945 Rat 724520 Bp145 Blood pressure QTL 145 2.1 0.0024 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 20784828 65784828 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 6903308 Scl36 Serum cholesterol QTL 36 2 0.0125 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 53863041 90532583 Rat 2313092 Bmd72 Bone mineral density QTL 72 2.5 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 11481312 82174945 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 2313097 Bss70 Bone structure and strength QTL 70 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 9589820 Insglur3 Insulin/glucose ratio QTL 3 10.75 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 1 34836858 79836858 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 738020 Pia8 Pristane induced arthritis QTL 8 4.7 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 1 65833076 Rat 1354599 Bw29 Body weight QTL 29 3.46 0.001 body mass (VT:0001259) body weight (CMO:0000012) 1 33449848 78449848 Rat 2302038 Pia31 Pristane induced arthritis QTL 31 5.5 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 1 10992065 55992065 Rat 4889919 Bss86 Bone structure and strength QTL 86 4.1 tibia area (VT:1000281) tibia midshaft total cross-sectional area (CMO:0001715) 1 53895117 82174945 Rat 8552948 Pigfal11 Plasma insulin-like growth factor 1 level QTL 11 4.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 1 34836858 79836858 Rat 634353 Rends2 Renal damage susceptibility QTL 2 0.05 kidney blood vessel morphology trait (VT:0000530) organ lesion measurement (CMO:0000677) 1 19333571 56983283 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat
D1Rat207
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 1 63,973,581 - 63,973,789 (+) Marker Load Pipeline mRatBN7.2 1 55,300,427 - 55,300,635 (+) MAPPER mRatBN7.2 Rnor_6.0 1 56,282,757 - 56,282,964 NCBI Rnor6.0 Rnor_5.0 1 57,473,569 - 57,473,776 UniSTS Rnor5.0 RGSC_v3.4 1 53,203,564 - 53,203,820 RGD RGSC3.4 RGSC_v3.4 1 53,203,603 - 53,203,810 UniSTS RGSC3.4 RGSC_v3.1 1 53,206,548 - 53,206,755 RGD Celera 1 51,518,460 - 51,518,667 UniSTS RH 3.4 Map 1 672.2 UniSTS RH 3.4 Map 1 672.2 RGD RH 2.0 Map 1 391.3 RGD FHH x ACI Map 1 30.3199 RGD Cytogenetic Map 1 q12 UniSTS
D17Jcs34
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 55,313,802 - 55,314,071 (+) MAPPER mRatBN7.2 Rnor_6.0 1 56,296,133 - 56,296,401 NCBI Rnor6.0 Rnor_5.0 1 57,486,945 - 57,487,213 UniSTS Rnor5.0 RGSC_v3.4 1 53,216,979 - 53,217,247 UniSTS RGSC3.4 Celera 1 51,531,828 - 51,532,096 UniSTS Cytogenetic Map 1 q12 UniSTS
RH130327
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 55,391,499 - 55,391,693 (+) MAPPER mRatBN7.2 Rnor_6.0 1 56,373,791 - 56,373,984 NCBI Rnor6.0 Rnor_5.0 1 57,565,121 - 57,565,314 UniSTS Rnor5.0 RGSC_v3.4 1 53,294,929 - 53,295,122 UniSTS RGSC3.4 Celera 1 51,609,097 - 51,609,290 UniSTS RH 3.4 Map 1 673.0 UniSTS Cytogenetic Map 1 q12 UniSTS
BM387775
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 55,380,237 - 55,380,411 (+) MAPPER mRatBN7.2 Rnor_6.0 1 56,362,532 - 56,362,705 NCBI Rnor6.0 Rnor_5.0 1 57,553,862 - 57,554,035 UniSTS Rnor5.0 RGSC_v3.4 1 53,283,670 - 53,283,843 UniSTS RGSC3.4 Celera 1 51,597,838 - 51,598,011 UniSTS RH 3.4 Map 1 675.2 UniSTS Cytogenetic Map 1 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000019317 ⟹ ENSRNOP00000019317
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 55,262,530 - 55,391,693 (+) Ensembl Rnor_6.0 Ensembl 1 56,242,346 - 56,373,984 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000079718 ⟹ ENSRNOP00000071488
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 55,306,478 - 55,391,693 (+) Ensembl Rnor_6.0 Ensembl 1 56,288,832 - 56,374,120 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000109266 ⟹ ENSRNOP00000089764
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 55,262,530 - 55,307,228 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000113274 ⟹ ENSRNOP00000078071
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 55,306,478 - 55,386,655 (+) Ensembl
RefSeq Acc Id:
NM_001106215 ⟹ NP_001099685
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 63,935,689 - 64,064,866 (+) NCBI mRatBN7.2 1 55,262,530 - 55,391,716 (+) NCBI Rnor_6.0 1 56,242,346 - 56,374,007 (+) NCBI Rnor_5.0 1 57,434,118 - 57,565,436 (+) NCBI RGSC_v3.4 1 53,165,792 - 53,295,145 (+) RGD Celera 1 51,480,576 - 51,609,313 (+) RGD
Sequence:
CCCGGCCGGAGCGCACGGAGGGGCCGTGCGGTCTCCACCAGAGGCGGTAGGACCGCAGAGCAGTTCTTGACCCCTCGCTCTCGCGTTCGCACACCGGATCTTCGCCGAGTGCCTGGGTGCAGCGTGTG
hide sequence
RefSeq Acc Id:
XM_006227958 ⟹ XP_006228020
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 63,935,627 - 64,064,952 (+) NCBI mRatBN7.2 1 55,262,472 - 55,391,804 (+) NCBI Rnor_6.0 1 56,242,289 - 56,374,106 (+) NCBI Rnor_5.0 1 57,434,118 - 57,565,436 (+) NCBI
Sequence:
CGGGAAACTAGGGTTATTTGACAGCAGCAGGGGCAGCCGAAGAAGAGTTCGTGGAGCCCCGGCC
hide sequence
RefSeq Acc Id:
NP_001099685 ⟸ NM_001106215
- Peptide Label:
precursor
- UniProtKB:
B5DF75 (UniProtKB/TrEMBL), A0A0G2K0K9 (UniProtKB/TrEMBL)
- Sequence:
MLPPQLCWLPLLAALLPPVPAQKFSALTFLRVDQDKDRDCSLDCPSSPQKPLCASDGRTFLSRCEFQRAKCKDPQLEIAHRGNCKDVSRCVAERKYTQEQARKEFQQVFIPECNDDGTYSQVQCHSYT
hide sequence
RefSeq Acc Id:
XP_006228020 ⟸ XM_006227958
- Peptide Label:
isoform X1
- UniProtKB:
F7FPL2 (UniProtKB/TrEMBL), A0A0G2K0K9 (UniProtKB/TrEMBL)
- Sequence:
MLPPQLCWLPLLAALLPPVPAQKFSALTFLRVDQDKDRDCSLDCPSSPQKPLCASDGRTFLSRC
hide sequence
Ensembl Acc Id:
ENSRNOP00000071488 ⟸ ENSRNOT00000079718
Ensembl Acc Id:
ENSRNOP00000019317 ⟸ ENSRNOT00000019317
Ensembl Acc Id:
ENSRNOP00000089764 ⟸ ENSRNOT00000109266
Ensembl Acc Id:
ENSRNOP00000078071 ⟸ ENSRNOT00000113274
RGD ID: 13689636 Promoter ID: EPDNEW_R161 Type: multiple initiation site Name: Smoc2_1 Description: SPARC related modular calcium binding 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 56,242,332 - 56,242,392 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Smoc2
SPARC related modular calcium binding 2
Smoc2_predicted
SPARC related modular calcium binding 2 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Smoc2_predicted
SPARC related modular calcium binding 2 (predicted)
Symbol and Name status set to approved
70820 APPROVED
