Advanced Search (OLGA)

Gene: Klk7 (kallikrein-related peptidase 7) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Klk7

Name:

kallikrein-related peptidase 7

RGD ID:

1306420

Description:

Predicted to enable serine-type endopeptidase activity. Predicted to be involved in positive regulation of antibacterial peptide production; regulation of systemic arterial blood pressure; and zymogen activation. Predicted to be located in epidermal lamellar body. Predicted to be active in cornified envelope; extracellular space; and secretory granule. Orthologous to human KLK7 (kallikrein related peptidase 7); INTERACTS WITH 6-propyl-2-thiouracil; acrylamide; alpha-Zearalanol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

kallikrein 7 (chymotryptic, stratum corneum); kallikrein related-peptidase 7 (chymotryptic, stratum corneum); kallikrein-7; LOC292852

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	KLK7 (kallikrein related peptidase 7)	HGNC	Ensembl, HomoloGene, NCBI, OrthoMCL, PhylomeDB, Treefam
Mus musculus (house mouse):	Klk7 (kallikrein related-peptidase 7 (chymotryptic, stratum corneum))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Klk7 (kallikrein related peptidase 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	KLK7 (kallikrein related peptidase 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	KLK7 (kallikrein related peptidase 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Klk7 (kallikrein related peptidase 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	KLK7 (kallikrein related peptidase 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	KLK7 (kallikrein related peptidase 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Klk7 (kallikrein related peptidase 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	KLK1 (kallikrein 1)	HGNC	Panther
Alliance orthologs ³
Mus musculus (house mouse):	Klk1b26 (kallikrein 1-related petidase b26)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Klk1 (kallikrein 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	KLK7 (kallikrein related peptidase 7)	Alliance	DIOPT (HGNC)
Homo sapiens (human):	KLK1 (kallikrein 1)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	Klk1b3 (kallikrein 1-related peptidase b3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Klk1b4 (kallikrein 1-related pepidase b4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Klk1b8 (kallikrein 1-related peptidase b8)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Mus musculus (house mouse):	Klk1b1 (kallikrein 1-related peptidase b1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Klk1b5 (kallikrein 1-related peptidase b5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Klk1b27 (kallikrein 1-related peptidase b27)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Klk1b24 (kallikrein 1-related peptidase b24)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Klk1b21 (kallikrein 1-related peptidase b21)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Klk1b16 (kallikrein 1-related peptidase b16)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Mus musculus (house mouse):	Klk1b11 (kallikrein 1-related peptidase b11)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Klk1b9 (kallikrein 1-related peptidase b9)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Egfbp2 (epidermal growth factor binding protein type B)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Klk1b22 (kallikrein 1-related peptidase b22)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG32374	Alliance	DIOPT (InParanoid\|OrthoInspector\|SonicParanoid)

Candidate Gene For:

Bp267

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	103,403,206 - 103,407,907 (+)	NCBI		GRCr8
mRatBN7.2	1	94,267,170 - 94,271,361 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	94,266,605 - 94,271,332 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	99,652,577 - 99,656,768 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	108,125,248 - 108,129,439 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	101,414,839 - 101,419,040 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	99,749,991 - 99,754,723 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	99,749,936 - 99,754,435 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	100,818,808 - 100,823,452 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	94,243,421 - 94,246,711 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	94,320,659 - 94,323,995 (+)	NCBI
Celera	1	88,535,508 - 88,538,798 (+)	NCBI		Celera
Cytogenetic Map	1	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Klk7	Rat	17beta-estradiol	multiple interactions	ISO	KLK7 (Homo sapiens)	6480464	[Estradiol co-treated with TGFB1 protein] results in decreased expression of KLK7 mRNA	CTD	PMID:30165855
Klk7	Rat	17beta-hydroxy-5alpha-androstan-3-one	increases expression	ISO	KLK7 (Homo sapiens)	6480464	Dihydrotestosterone results in increased expression of KLK7 mRNA	CTD	PMID:17254854
Klk7	Rat	4,4'-diaminodiphenylmethane	decreases expression	ISO	Klk7 (Mus musculus)	6480464	4 and 4'-diaminodiphenylmethane results in decreased expression of KLK7 mRNA	CTD	PMID:18648102
Klk7	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of KLK7 mRNA	CTD	PMID:24780913
Klk7	Rat	acrylamide	decreases expression	EXP		6480464	Acrylamide results in decreased expression of KLK7 mRNA	CTD	PMID:28959563
Klk7	Rat	all-trans-retinoic acid	increases expression	ISO	KLK7 (Homo sapiens)	6480464	Tretinoin results in increased expression of KLK7 mRNA	CTD	PMID:16249480
Klk7	Rat	alpha-Zearalanol	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of KLK7 mRNA	CTD	PMID:35163327
Klk7	Rat	alpha-Zearalanol	decreases expression	EXP		6480464	Zeranol results in decreased expression of KLK7 mRNA	CTD	PMID:35163327
Klk7	Rat	aristolochic acid A	decreases expression	EXP		6480464	aristolochic acid I results in decreased expression of KLK7 mRNA	CTD	PMID:17483316
Klk7	Rat	arsane	multiple interactions	ISO	KLK7 (Homo sapiens)	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of KLK7 mRNA	CTD	PMID:32525701
Klk7	Rat	arsenic atom	multiple interactions	ISO	KLK7 (Homo sapiens)	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of KLK7 mRNA	CTD	PMID:32525701
Klk7	Rat	benzo[a]pyrene	multiple interactions	ISO	Klk7 (Mus musculus)	6480464	Benzo(a)pyrene promotes the reaction [AHR protein binds to KLK7 promoter]	CTD	PMID:19654925
Klk7	Rat	benzo[a]pyrene	increases methylation	ISO	KLK7 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of KLK7 5' UTR and Benzo(a)pyrene results in increased methylation of KLK7 promoter	CTD	PMID:27901495
Klk7	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	KLK7 (Homo sapiens)	6480464	Diethylhexyl Phthalate results in decreased expression of KLK7 mRNA	CTD	PMID:31163220
Klk7	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of KLK7 mRNA	CTD	PMID:25181051
Klk7	Rat	cadmium atom	increases expression	ISO	KLK7 (Homo sapiens)	6480464	Cadmium results in increased expression of KLK7 mRNA	CTD	PMID:21120746
Klk7	Rat	calcitriol	increases expression	ISO	KLK7 (Homo sapiens)	6480464	Calcitriol results in increased expression of KLK7 mRNA	CTD	PMID:26485663
Klk7	Rat	carbamazepine	affects expression	ISO	KLK7 (Homo sapiens)	6480464	Carbamazepine affects the expression of KLK7 mRNA	CTD	PMID:25979313
Klk7	Rat	CGP 52608	multiple interactions	ISO	KLK7 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to KLK7 gene]	CTD	PMID:28238834
Klk7	Rat	cisplatin	affects response to substance	ISO	KLK7 (Homo sapiens)	6480464	KLK7 protein affects the susceptibility to Cisplatin	CTD	PMID:16217747
Klk7	Rat	exemestane	increases expression	ISO	KLK7 (Homo sapiens)	6480464	exemestane results in increased expression of KLK7 mRNA	CTD	PMID:17254854
Klk7	Rat	formaldehyde	decreases expression	ISO	KLK7 (Homo sapiens)	6480464	Formaldehyde results in decreased expression of KLK7 mRNA	CTD	PMID:27905399
Klk7	Rat	furan	increases methylation	EXP		6480464	furan results in increased methylation of KLK7 gene	CTD	PMID:22079235
Klk7	Rat	indole-3-methanol	affects expression	EXP		6480464	indole-3-carbinol affects the expression of KLK7 mRNA	CTD	PMID:21396975
Klk7	Rat	pentanal	increases expression	ISO	KLK7 (Homo sapiens)	6480464	pentanal results in increased expression of KLK7 mRNA	CTD	PMID:26079696
Klk7	Rat	perfluorohexanesulfonic acid	increases expression	ISO	Klk7 (Mus musculus)	6480464	perfluorohexanesulfonic acid results in increased expression of KLK7 mRNA	CTD	PMID:37995155
Klk7	Rat	perfluorooctanoic acid	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of KLK7 mRNA	CTD	PMID:35163327
Klk7	Rat	potassium dichromate	increases expression	ISO	Klk7 (Mus musculus)	6480464	Potassium Dichromate results in increased expression of KLK7 mRNA	CTD	PMID:23608068
Klk7	Rat	sodium arsenate	multiple interactions	ISO	KLK7 (Homo sapiens)	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of KLK7 mRNA	CTD	PMID:32525701
Klk7	Rat	sodium arsenite	decreases expression	ISO	KLK7 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of KLK7 mRNA	CTD	PMID:12634122
Klk7	Rat	sodium arsenite	increases expression	ISO	Klk7 (Mus musculus)	6480464	sodium arsenite results in increased expression of KLK7 mRNA	CTD	PMID:37682722
Klk7	Rat	sodium fluoride	decreases expression	ISO	Klk7 (Mus musculus)	6480464	Sodium Fluoride results in decreased expression of KLK7 mRNA	CTD	PMID:27862939
Klk7	Rat	Tesaglitazar	increases expression	EXP		6480464	tesaglitazar results in increased expression of KLK7 mRNA	CTD	PMID:21515302
Klk7	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of KLK7 mRNA	CTD	PMID:23411599
Klk7	Rat	trichloroethene	decreases expression	EXP		6480464	Trichloroethylene results in decreased expression of KLK7 mRNA	CTD	PMID:33387578
Klk7	Rat	triclosan	increases expression	ISO	KLK7 (Homo sapiens)	6480464	Triclosan results in increased expression of KLK7 mRNA	CTD	PMID:30510588

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Klk7	Rat	biological_process		ND		1598407	02/09: no relevant rat data	RGD
Klk7	Rat	positive regulation of antibacterial peptide production	involved_in	IEA	UniProtKB:P49862 and ensembl:ENSP00000470538	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Klk7	Rat	positive regulation of antibacterial peptide production	involved_in	ISO	KLK7 (Homo sapiens)	1624291	PMID:17012259	RGD	PMID:17012259
Klk7	Rat	proteolysis	involved_in	IEA	UniProtKB-KW:KW-0645	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Klk7	Rat	proteolysis	involved_in	IEA	InterPro:IPR001254 and InterPro:IPR018114	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Klk7	Rat	cornified envelope	is_active_in	ISO	Klk7 (Mus musculus)	1624291	PMID:26644517	RGD	PMID:26644517
Klk7	Rat	cornified envelope	is_active_in	IEA	UniProtKB:Q91VE3 and ensembl:ENSMUSP00000032955	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Klk7	Rat	epidermal lamellar body	located_in	IEA	UniProtKB:P49862 and ensembl:ENSP00000470538	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Klk7	Rat	epidermal lamellar body	located_in	ISO	KLK7 (Homo sapiens)	1624291	PMID:15675955	RGD	PMID:15675955
Klk7	Rat	extracellular space	located_in	IEA	UniProtKB:P49862 and ensembl:ENSP00000470538	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Klk7	Rat	extracellular space	located_in	ISO	KLK7 (Homo sapiens)	1624291	PMID:17012259	RGD	PMID:17012259

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Klk7	Rat	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Klk7	Rat	peptidase activity	enables	ISO	KLK7 (Homo sapiens)	1624291	PMID:17012259	RGD	PMID:17012259
Klk7	Rat	peptidase activity	enables	IEA	UniProtKB:P49862 and ensembl:ENSP00000470538	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Klk7	Rat	peptidase activity	enables	IEA	UniProtKB-KW:KW-0645	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Klk7	Rat	serine-type endopeptidase activity	enables	IEA	InterPro:IPR001254 and InterPro:IPR018114	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Klk7	Rat	serine-type peptidase activity	enables	IEA	UniProtKB-KW:KW-0720	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

#	Reference Title	Reference Citation
1.	Klk1 as one of the genes contributing to hypertension in Dahl salt-sensitive rat.	Iwai N, etal., Hypertension 2005 May;45(5):947-53. Epub 2005 Apr 4.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Comprehensive gene review and curation	RGD comprehensive gene curation

PMID:2183721	PMID:2194829	PMID:2849988	PMID:3482210	PMID:15675955	PMID:17012259	PMID:21873635	PMID:33450132

Klk7
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	103,403,206 - 103,407,907 (+)	NCBI		GRCr8
mRatBN7.2	1	94,267,170 - 94,271,361 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	94,266,605 - 94,271,332 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	99,652,577 - 99,656,768 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	108,125,248 - 108,129,439 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	101,414,839 - 101,419,040 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	99,749,991 - 99,754,723 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	99,749,936 - 99,754,435 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	100,818,808 - 100,823,452 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	94,243,421 - 94,246,711 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	94,320,659 - 94,323,995 (+)	NCBI
Celera	1	88,535,508 - 88,538,798 (+)	NCBI		Celera
Cytogenetic Map	1	q22	NCBI

KLK7
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	50,976,468 - 50,984,064 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	50,976,468 - 50,984,099 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	51,479,724 - 51,487,320 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	56,171,541 - 56,178,962 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	19	48,531,233 - 48,539,211 (-)	NCBI		Celera
Cytogenetic Map	19	q13.41	NCBI
HuRef	19	47,813,130 - 47,820,053 (-)	NCBI		HuRef
CHM1_1	19	51,481,810 - 51,489,320 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	54,064,867 - 54,072,534 (-)	NCBI		T2T-CHM13v2.0

Klk7
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	43,460,718 - 43,465,811 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	43,460,718 - 43,465,783 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	43,811,294 - 43,816,387 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	43,811,294 - 43,816,359 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	51,066,814 - 51,071,729 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	43,679,486 - 43,684,401 (+)	NCBI		MGSCv36	mm8
Celera	7	39,278,059 - 39,282,925 (+)	NCBI		Celera
Cytogenetic Map	7	B3	NCBI
cM Map	7	28.27	NCBI

Klk7
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955558	1,490,120 - 1,494,993 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955558	1,490,884 - 1,494,843 (+)	NCBI	ChiLan1.0	ChiLan1.0

KLK7
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	57,046,646 - 57,053,670 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	58,967,738 - 58,974,995 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	47,944,072 - 47,951,506 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

KLK7
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	105,891,206 - 105,895,441 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	105,464,096 - 105,467,219 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	106,399,900 - 106,404,253 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	106,400,435 - 106,403,750 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	106,071,917 - 106,075,040 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	105,713,325 - 105,716,448 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	106,508,823 - 106,511,946 (+)	NCBI		UU_Cfam_GSD_1.0

Klk7
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	22,761,330 - 22,766,037 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936889	637,996 - 641,126 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936889	637,526 - 641,126 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

KLK7
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	55,644,628 - 55,648,961 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	55,644,627 - 55,649,000 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

KLK7
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	43,998,661 - 44,021,478 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666073	24,022,871 - 24,029,762 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Klk7
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624832	3,775,252 - 3,778,432 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624832	3,774,837 - 3,778,646 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Klk7
11 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	439
Count of miRNA genes:	244
Interacting mature miRNAs:	288
Transcripts:	ENSRNOT00000025299
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	78479925	123479925	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
2300324	Fetw1	Fetal weight QTL 1	12.1	0.005	fetal growth trait (VT:0004201)	fetal body weight (CMO:0002080)	1	85424647	100358001	Rat
1300121	Hrtrt1	Heart rate QTL 1	3.7		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	65789093	115540829	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	66023617	118608521	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	90532338	123479925	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	77876254	106047988	Rat
2313083	Bmd74	Bone mineral density QTL 74	4	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	82174743	118944897	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
4889494	Scort2	Serum corticosterone level QTL 2	4.2		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	80592172	125592172	Rat
724567	Tcas6	Tongue tumor susceptibility QTL 6	6.85		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	1	92948896	144267916	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
61344	Bp29	Blood pressure QTL 29	7.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	78350581	123350581	Rat
724521	Uae1	Urinary albumin excretion QTL 1	3.8	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	90508614	173018436	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	90508614	180359386	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	77494165	122494165	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
1300153	Bp171	Blood pressure QTL 171	3.37		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	90664883	143200202	Rat
738022	Anxrr13	Anxiety related response QTL 13	4.6	0.00039	locomotor behavior trait (VT:0001392)	number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514)	1	83547917	128547917	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	50343510	99980958	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	77857876	122857876	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	78430536	123430536	Rat
2293142	Bp314	Blood pressure QTL 314			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	92184926	137184926	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat
724529	Cm16	Cardiac mass QTL 16	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	1	87580395	150700247	Rat

BM384404

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	94,270,781 - 94,270,957 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	99,754,144 - 99,754,319	NCBI	Rnor6.0
Rnor_5.0	1	100,822,902 - 100,823,077	UniSTS	Rnor5.0
RGSC_v3.4	1	94,246,161 - 94,246,336	UniSTS	RGSC3.4
Celera	1	88,538,248 - 88,538,423	UniSTS
RH 3.4 Map	1	906.9	UniSTS
Cytogenetic Map	1	q22	UniSTS

UniSTS:235957

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	94,268,121 - 94,268,460 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	99,751,484 - 99,751,822	NCBI	Rnor6.0
Rnor_5.0	1	100,820,242 - 100,820,580	UniSTS	Rnor5.0
RGSC_v3.4	1	94,243,501 - 94,243,839	UniSTS	RGSC3.4
Celera	1	88,535,588 - 88,535,926	UniSTS
Cytogenetic Map	1	q22	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
8	1	32	19	25	2	9	2	6	34	11	25	12	35	23


RefSeq Transcripts	NM_001106254	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006228988	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063283851	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000025299 ⟹ ENSRNOP00000025299

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	94,266,605 - 94,271,332 (+)	Ensembl
Rnor_6.0 Ensembl	1	99,749,936 - 99,754,435 (+)	Ensembl

RefSeq Acc Id:

NM_001106254 ⟹ NP_001099724

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	103,403,716 - 103,407,907 (+)	NCBI
mRatBN7.2	1	94,267,170 - 94,271,361 (+)	NCBI
Rnor_6.0	1	99,751,404 - 99,754,694 (+)	NCBI
Rnor_5.0	1	100,818,808 - 100,823,452 (+)	NCBI
RGSC_v3.4	1	94,243,421 - 94,246,711 (+)	RGD
Celera	1	88,535,508 - 88,538,798 (+)	RGD

Sequence:

show sequence

TCAGTACACGGTGCATCTGGGCAGTGATAAGATAGAGGATCAGAGTGCCCAGAGGATCAAGGCTTCAAGGTCATTCCGACACCCTGGCTACTCCACAAGGACCCATGTCAATGACATCATGCTTGTGA
AGATGGATAAGCCGGTCAAGATGTCAGACAAGGTGCAGAAAGTCAAGCTTCCTGATCACTGTGAACCCCCAGGGACATTGTGCACCGTCTCTGGATGGGGCACCACAACCAGCCCAGATGTGACCTTC
CCCTCGGATCTTATGTGCTCGGATGTGAAGCTCATCTCCTCCCAGGAGTGCAAGAAGGTGTATAAGGATCTTCTGGGGAAAACCATGCTGTGTGCTGGCATTCCCGACTCTAAGACTAACACATGCAA
TGGTGACTCAGGGGGGCCCTTGGTGTGCAATGACACCCTTCAAGGTCTGGTGTCCTGGGGAACCTACCCTTGTGGCCAGCCGAATGACCCAGGAGTCTACACTCAAGTCTGCAAGTACCAACGGTGGT
TGGAGGACACCATGAAAACCTATCGCTAACGTGCCAGGAGGGCAAGCTGCCAGCCTGGAAGGCTGTGTAAAGCCCTGCCTGGCTTTACCTTTCCTCCAGGACATAGCAAAACCTCAACACTACGTTAA
GTTTATAAGCCAATCAGAACCCCAGAGACCAAAAAGCAAATCAAGTCAGGAGACTGAGAACCTGAGGGCTATGGAAGATGCCAGAAGAACTAAAACTTCCAAATGCAGTAGCTTGAGGATTCCTACGG
TCCTTTATTGGAAAGTGGCTGCTAACTGTGAGACCTTCATCCACTGCCTTGGACTCAGGCCATCCATTTCTAGAGTTCTTTAAAAAAAATAGAATCAAATTTGGATTCATTACATTACTTATTGTAGA
GGAAAAAGAACGGAAACTGTCAACATGTTCACAATAGTAGATTATTTCAGTGAAAGTTCGATTTCTCTCACTATGAAGTTGTGGGAAATACCGCGTATGCTGTGGTGCTCAGCCTTGTCCCCGAGGGA
CTGTTGTTGTCTGATGTTTAATGGGGACATGGGCTGGACATACCCAATGAATACTGATGAGACAGAATAAAATCTAAGTGATATCGATGTGTGTGCTCATAGCCTGGAAAATAATGTTGGGGAGCTGG
GAGCATTGATGGTGGAGGGAAGAGACCTATGAGGAAGAGTTGGCAAGATGGCTCAGTGGGTAAGAACACTTGCTGCCAAGCCTGACATGACCTCTGGGGCCTGCACGGTGGAAGGGAGTAACTGATTC
CTGCATACTTCCCCCTGACCTCCAGATGTGCGAAGGCACATGTGTACCTGCACACATACATTGACACAAAACCAGATTGAAGTGTAAAT

hide sequence

RefSeq Acc Id:

XM_063283851 ⟹ XP_063139921

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	103,403,206 - 103,407,907 (+)	NCBI


Protein RefSeqs	NP_001099724	(Get FASTA)	NCBI Sequence Viewer
	XP_063139921	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM07533	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000025299
	ENSRNOP00000025299.5

RefSeq Acc Id:	NP_001099724 ⟸ NM_001106254
- Peptide Label:	precursor
- UniProtKB:	D3ZZY0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLVKMDKPVKMSDKVQKVKLPDHCEPPGTLCTVSGWGTTTSPDVTFPSDLMCSDVKLISSQECKKVYKDLLGKTMLCAGIPDSKTNTCNGDSGGPLVCNDTLQGLVSWGTYPCGQPNDPGVYTQVCKY QRWLEDTMKTYR hide sequence

Ensembl Acc Id:

ENSRNOP00000025299 ⟸ ENSRNOT00000025299

RefSeq Acc Id:	XP_063139921 ⟸ XM_063283851
- Peptide Label:	isoform X1
- UniProtKB:	D3ZZY0 (UniProtKB/TrEMBL)

Protein Domains

Peptidase S1

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13689991

Promoter ID:

EPDNEW_R513

Type:

single initiation site

Name:

Klk7_1

Description:

kallikrein-related peptidase 7

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	99,750,021 - 99,750,081	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-59819	BioCyc
Ensembl Genes	ENSRNOG00000018664	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000025299	ENTREZGENE
	ENSRNOT00000025299.7	UniProtKB/TrEMBL
Gene3D-CATH	2.40.10.10	UniProtKB/TrEMBL
InterPro	Peptidase_S1	UniProtKB/TrEMBL
	Peptidase_S1_AS	UniProtKB/TrEMBL
	Peptidase_S1_PA_chymotrypsin	UniProtKB/TrEMBL
	Peptidase_S1A	UniProtKB/TrEMBL
	Trypsin-like_Pept_dom	UniProtKB/TrEMBL
	TRYPSIN_SER	UniProtKB/TrEMBL
KEGG Report	rno:292852	UniProtKB/TrEMBL
NCBI Gene	292852	ENTREZGENE
PANTHER	KALLIKREIN-7	UniProtKB/TrEMBL
	KALLIKREIN-RELATED	UniProtKB/TrEMBL
Pfam	Trypsin	UniProtKB/TrEMBL
PhenoGen	Klk7	PhenoGen
PRINTS	CHYMOTRYPSIN	UniProtKB/TrEMBL
PROSITE	TRYPSIN_DOM	UniProtKB/TrEMBL
	TRYPSIN_HIS	UniProtKB/TrEMBL
	TRYPSIN_SER	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000018664	RatGTEx
SMART	Tryp_SPc	UniProtKB/TrEMBL
Superfamily-SCOP	SSF50494	UniProtKB/TrEMBL
UniProt	A6JAK1_RAT	UniProtKB/TrEMBL
	D3ZZY0	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-11-17	Klk7	kallikrein-related peptidase 7	Klk7	kallikrein related-peptidase 7 (chymotryptic, stratum corneum)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-04	Klk7	kallikrein related-peptidase 7 (chymotryptic, stratum corneum)	Klk7_predicted	kallikrein 7 (chymotryptic, stratum corneum) (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-12	Klk7_predicted	kallikrein 7 (chymotryptic, stratum corneum) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Note Type	Note	Reference
gene_expression	mRNA levels were significantly reduced in kidneys of Dahl salt-sensitive rats compared to Lewis rats	1358144

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message