Symbol:
Pdcd1lg2
Name:
programmed cell death 1 ligand 2
RGD ID:
1306403
Description:
Predicted to be involved in several processes, including cellular response to lipopolysaccharide; negative regulation of cytokine production; and regulation of T cell activation. Predicted to be active in external side of plasma membrane. Orthologous to human PDCD1LG2 (programmed cell death 1 ligand 2); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; alpha-Zearalanol; bisphenol A.
Type:
protein-coding
RefSeq Status:
INFERRED
Previously known as:
LOC309304; PD-1 ligand 2; PD-L2; PDCD1 ligand 2; programmed death ligand 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 236,572,497 - 236,637,490 (+) NCBI GRCr8 mRatBN7.2 1 227,158,941 - 227,223,938 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 227,158,941 - 227,223,938 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 235,560,639 - 235,625,650 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 242,490,304 - 242,555,322 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 235,308,069 - 235,373,343 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 247,562,202 - 247,629,279 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 247,562,202 - 247,627,193 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 254,810,377 - 254,876,025 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 233,090,444 - 233,156,412 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 233,273,427 - 233,368,190 (+) NCBI Celera 1 224,309,877 - 224,374,794 (+) NCBI Celera Cytogenetic Map 1 q52 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pdcd1lg2 Rat 17beta-estradiol multiple interactions ISO RGD:1314998 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of PDCD1LG2 mRNA CTD PMID:30165855 Pdcd1lg2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1552436 6480464 Tetrachlorodibenzodioxin affects the expression of PDCD1LG2 mRNA CTD PMID:21570461 Pdcd1lg2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PDCD1LG2 mRNA CTD PMID:34747641 Pdcd1lg2 Rat 2-palmitoylglycerol increases expression ISO RGD:1314998 6480464 2-palmitoylglycerol results in increased expression of PDCD1LG2 mRNA CTD PMID:37199045 Pdcd1lg2 Rat 4,4'-sulfonyldiphenol increases methylation ISO RGD:1552436 6480464 bisphenol S results in increased methylation of PDCD1LG2 exon CTD PMID:33297965 Pdcd1lg2 Rat 4,4'-sulfonyldiphenol multiple interactions ISO RGD:1314998 6480464 [bisphenol S co-treated with Fulvestrant] results in increased methylation of PDCD1LG2 gene CTD PMID:31601247 Pdcd1lg2 Rat 5-fluorouracil multiple interactions ISO RGD:1314998 6480464 TP53 protein affects the reaction [Fluorouracil results in decreased expression of PDCD1LG2 mRNA] CTD PMID:15016801 Pdcd1lg2 Rat all-trans-retinoic acid increases expression ISO RGD:1314998 6480464 Tretinoin results in increased expression of PDCD1LG2 mRNA CTD PMID:33167477 Pdcd1lg2 Rat alpha-amanitin affects expression ISO RGD:1552436 6480464 Alpha-Amanitin affects the expression of PDCD1LG2 mRNA CTD PMID:38531469 Pdcd1lg2 Rat alpha-Zearalanol increases expression EXP 6480464 Zeranol results in increased expression of PDCD1LG2 mRNA CTD PMID:35163327 Pdcd1lg2 Rat aripiprazole multiple interactions ISO RGD:1314998 6480464 [Aripiprazole co-treated with Ozone] results in increased expression of PDCD1LG2 mRNA CTD PMID:31476115 Pdcd1lg2 Rat arsane multiple interactions ISO RGD:1314998 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Pdcd1lg2 Rat arsenic atom multiple interactions ISO RGD:1314998 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Pdcd1lg2 Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:1314998 6480464 Diethylhexyl Phthalate results in increased expression of PDCD1LG2 mRNA CTD PMID:31163220 Pdcd1lg2 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in decreased expression of PDCD1LG2 mRNA CTD PMID:26496021 Pdcd1lg2 Rat bisphenol A decreases methylation ISO RGD:1314998 6480464 bisphenol A results in decreased methylation of PDCD1LG2 gene CTD PMID:31601247 Pdcd1lg2 Rat bisphenol A decreases expression ISO RGD:1314998 6480464 bisphenol A results in decreased expression of PDCD1LG2 mRNA CTD PMID:29275510 Pdcd1lg2 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of PDCD1LG2 gene CTD PMID:28505145 Pdcd1lg2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PDCD1LG2 mRNA CTD PMID:25181051 Pdcd1lg2 Rat carbon nanotube increases expression ISO RGD:1552436 6480464 Nanotubes, Carbon analog results in increased expression of PDCD1LG2 mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 Pdcd1lg2 Rat carboplatin decreases expression ISO RGD:1314998 6480464 Carboplatin results in decreased expression of PDCD1LG2 CTD PMID:21765211 Pdcd1lg2 Rat carboplatin multiple interactions ISO RGD:1552436 6480464 STAT6 gene mutant form inhibits the reaction [Carboplatin results in decreased expression of PDCD1LG2] CTD PMID:21765211 Pdcd1lg2 Rat cisplatin multiple interactions ISO RGD:1314998 6480464 Cisplatin inhibits the reaction [[TNF co-treated with IL4] results in increased expression of PDCD1LG2]; Cisplatin more ... CTD PMID:21765211 Pdcd1lg2 Rat cisplatin decreases expression ISO RGD:1314998 6480464 Cisplatin results in decreased expression of PDCD1LG2 CTD PMID:21765211 Pdcd1lg2 Rat cobalt dichloride decreases expression ISO RGD:1314998 6480464 cobaltous chloride results in decreased expression of PDCD1LG2 mRNA CTD PMID:19320972 Pdcd1lg2 Rat diiodine multiple interactions ISO RGD:1552436 6480464 CD274 protein affects the reaction [Iodine results in increased expression of PDCD1LG2 mRNA] CTD PMID:37598415 Pdcd1lg2 Rat diiodine increases expression ISO RGD:1552436 6480464 Iodine results in increased expression of PDCD1LG2 mRNA CTD PMID:37598415 Pdcd1lg2 Rat dimethylarsinous acid increases expression ISO RGD:1314998 6480464 dimethylarsinous acid results in increased expression of PDCD1LG2 mRNA CTD PMID:23876855 Pdcd1lg2 Rat doxorubicin decreases expression ISO RGD:1314998 6480464 Doxorubicin results in decreased expression of PDCD1LG2 mRNA CTD PMID:29803840 Pdcd1lg2 Rat estriol increases expression ISO RGD:1552436 6480464 Estriol results in increased expression of PDCD1LG2 protein CTD PMID:21317386 Pdcd1lg2 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of PDCD1LG2 mRNA CTD PMID:24793618 Pdcd1lg2 Rat folic acid increases expression ISO RGD:1552436 6480464 Folic Acid results in increased expression of PDCD1LG2 mRNA CTD PMID:25629700 Pdcd1lg2 Rat fulvestrant multiple interactions ISO RGD:1314998 6480464 [bisphenol S co-treated with Fulvestrant] results in increased methylation of PDCD1LG2 gene CTD PMID:31601247 Pdcd1lg2 Rat lipopolysaccharide multiple interactions ISO RGD:1314998 6480464 Cisplatin inhibits the reaction [[TNF co-treated with Lipopolysaccharides] results in increased expression of PDCD1LG2] CTD PMID:21765211 Pdcd1lg2 Rat manganese atom multiple interactions ISO RGD:1314998 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Pdcd1lg2 Rat manganese(0) multiple interactions ISO RGD:1314998 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Pdcd1lg2 Rat manganese(II) chloride multiple interactions ISO RGD:1314998 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Pdcd1lg2 Rat oxaliplatin decreases expression ISO RGD:1314998 6480464 oxaliplatin results in decreased expression of PDCD1LG2 CTD PMID:21765211 Pdcd1lg2 Rat ozone increases expression ISO RGD:1314998 6480464 Ozone results in increased expression of PDCD1LG2 mRNA CTD PMID:31476115 Pdcd1lg2 Rat ozone multiple interactions ISO RGD:1314998 6480464 [Aripiprazole co-treated with Ozone] results in increased expression of PDCD1LG2 mRNA CTD PMID:31476115 Pdcd1lg2 Rat PD 0325901 multiple interactions ISO RGD:1314998 6480464 [(+)-JQ1 compound co-treated with mirdametinib] results in decreased expression of PDCD1LG2 mRNA CTD PMID:25119042 Pdcd1lg2 Rat potassium dichromate decreases expression ISO RGD:1552436 6480464 Potassium Dichromate results in decreased expression of PDCD1LG2 mRNA CTD PMID:23608068 Pdcd1lg2 Rat protein kinase inhibitor multiple interactions ISO RGD:1314998 6480464 Protein Kinase Inhibitors inhibits the reaction [gardiquimod results in increased expression of PDCD1LG2 mRNA] CTD PMID:28003376 Pdcd1lg2 Rat silicon dioxide increases expression ISO RGD:1552436 6480464 Silicon Dioxide results in increased expression of PDCD1LG2 mRNA CTD PMID:38811393 Pdcd1lg2 Rat sodium arsenite decreases expression ISO RGD:1314998 6480464 sodium arsenite results in decreased expression of PDCD1LG2 mRNA CTD PMID:34032870 Pdcd1lg2 Rat sodium arsenite multiple interactions ISO RGD:1314998 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Pdcd1lg2 Rat testosterone multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in decreased expression of PDCD1LG2 mRNA CTD PMID:26496021 Pdcd1lg2 Rat trimellitic anhydride increases expression ISO RGD:1552436 6480464 trimellitic anhydride results in increased expression of PDCD1LG2 mRNA CTD PMID:19042947
1.
Expression of programmed death 1 and its ligands in the liver of autoimmune hepatitis C57BL/6 mice.
Cao J, etal., Chin Med J (Engl). 2009 Aug 20;122(16):1941-6.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Dexmedetomidine Mitigates Microglia-Mediated Neuroinflammation through Upregulation of Programmed Cell Death Protein 1 in a Rat Spinal Cord Injury Model.
He H, etal., J Neurotrauma. 2018 Nov 1;35(21):2591-2603. doi: 10.1089/neu.2017.5625. Epub 2018 Jun 7.
5.
PD-L1 and PD-L2 have distinct roles in regulating host immunity to cutaneous leishmaniasis.
Liang SC, etal., Eur J Immunol. 2006 Jan;36(1):58-64. doi: 10.1002/eji.200535458.
6.
The PD-1/PD-L costimulatory pathway critically affects host resistance to the pathogenic fungus Histoplasma capsulatum.
Lázár-Molnár E, etal., Proc Natl Acad Sci U S A. 2008 Feb 19;105(7):2658-63. doi: 10.1073/pnas.0711918105. Epub 2008 Feb 11.
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
9.
Inhibiting the programmed death 1 pathway rescues Mycobacterium tuberculosis-specific interferon γ-producing T cells from apoptosis in patients with pulmonary tuberculosis.
Singh A, etal., J Infect Dis. 2013 Aug 15;208(4):603-15. doi: 10.1093/infdis/jit206. Epub 2013 May 9.
10.
Aberrant PD-1 ligand expression contributes to the myocardial inflammatory injury caused by Coxsackievirus B infection.
Wang T, etal., Antiviral Res. 2019 Jun;166:1-10. doi: 10.1016/j.antiviral.2019.03.007. Epub 2019 Mar 20.
11.
Lymphocyte subset expression and serum concentrations of PD-1/PD-L1 in sepsis - pilot study.
Wilson JK, etal., Crit Care. 2018 Apr 17;22(1):95. doi: 10.1186/s13054-018-2020-2.
Pdcd1lg2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 236,572,497 - 236,637,490 (+) NCBI GRCr8 mRatBN7.2 1 227,158,941 - 227,223,938 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 227,158,941 - 227,223,938 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 235,560,639 - 235,625,650 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 242,490,304 - 242,555,322 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 235,308,069 - 235,373,343 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 247,562,202 - 247,629,279 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 247,562,202 - 247,627,193 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 254,810,377 - 254,876,025 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 233,090,444 - 233,156,412 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 233,273,427 - 233,368,190 (+) NCBI Celera 1 224,309,877 - 224,374,794 (+) NCBI Celera Cytogenetic Map 1 q52 NCBI
PDCD1LG2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 5,510,531 - 5,571,282 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 5,510,531 - 5,571,282 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 5,510,531 - 5,571,282 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 5,500,570 - 5,560,398 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 5,500,569 - 5,560,398 NCBI Celera 9 5,436,182 - 5,496,918 (+) NCBI Celera Cytogenetic Map 9 p24.1 NCBI HuRef 9 5,466,254 - 5,526,976 (+) NCBI HuRef CHM1_1 9 5,510,742 - 5,571,459 (+) NCBI CHM1_1 T2T-CHM13v2.0 9 5,515,648 - 5,576,398 (+) NCBI T2T-CHM13v2.0
Pdcd1lg2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 29,388,319 - 29,450,327 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 29,388,319 - 29,448,561 (+) Ensembl GRCm39 Ensembl GRCm38 19 29,410,919 - 29,472,927 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 29,410,919 - 29,471,161 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 29,485,409 - 29,547,417 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 29,476,955 - 29,537,158 (+) NCBI MGSCv36 mm8 Celera 19 30,187,250 - 30,249,414 (+) NCBI Celera Cytogenetic Map 19 C1 NCBI cM Map 19 23.93 NCBI
Pdcd1lg2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955434 9,540,047 - 9,559,335 (+) NCBI ChiLan1.0 ChiLan1.0
PDCD1LG2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 119,001,068 - 119,078,909 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 119,006,121 - 119,084,767 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 5,313,071 - 5,391,676 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 5,514,449 - 5,575,660 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 5,514,449 - 5,575,688 (+) Ensembl panpan1.1 panPan2
PDCD1LG2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 93,631,676 - 93,698,560 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 93,631,979 - 93,689,266 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 94,040,062 - 94,127,750 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 94,185,676 - 94,272,591 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 94,185,807 - 94,254,813 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 93,817,857 - 93,905,923 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 93,542,645 - 93,630,714 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 94,306,830 - 94,395,104 (+) NCBI UU_Cfam_GSD_1.0
Pdcd1lg2
PDCD1LG2
PDCD1LG2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 73,938,194 - 73,998,028 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 73,938,042 - 73,997,770 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 62,327,991 - 62,387,861 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pdcd1lg2
.
Predicted Target Of
Count of predictions: 60 Count of miRNA genes: 55 Interacting mature miRNAs: 58 Transcripts: ENSRNOT00000021614 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
8693637 Alc29 Alcohol consumption QTL 29 2.7 0.258 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 1 207987464 234238494 Rat 1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1357335 Bw39 Body weight QTL 39 3.3 body mass (VT:0001259) body weight (CMO:0000012) 1 197814409 242814409 Rat 2302375 Bw83 Body weight QTL 83 4.87 0.0002 body mass (VT:0001259) body weight (CMO:0000012) 1 197697768 242697768 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2293674 Bss39 Bone structure and strength QTL 39 7.1 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 1 201554356 246554356 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 61455 Niddm7 Non-insulin dependent diabetes mellitus QTL 7 5.5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 214537555 238757011 Rat 61327 Eae7 Experimental allergic encephalomyelitis QTL 7 5.6 body mass (VT:0001259) change in body weight (CMO:0002045) 1 216255568 260522016 Rat 1600392 Bw123 Body weight QTL 123 0.001 body mass (VT:0001259) body weight (CMO:0000012) 1 223201027 260522016 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1600397 Edcs4 Endometrial carcinoma susceptibility QTL 4 2.2 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 1 206081677 251081677 Rat 631838 Niddm36 Non-insulin dependent diabetes mellitus QTL 36 0.01 insulin secretion trait (VT:0003564) calculated pancreatic islet insulin release measurement (CMO:0001217) 1 184550676 229550676 Rat 8693661 Alc34 Alcohol consumption QTL 34 2.2 0.611 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 1 207987464 228627600 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 2293694 Bss38 Bone structure and strength QTL 38 7.05 0.0001 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 1 201554356 246554356 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 734767 Niddm57 Non-insulin dependent diabetes mellitus QTL 57 body mass (VT:0001259) body weight (CMO:0000012) 1 224054293 260122809 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631215 Stl8 Serum triglyceride level QTL 8 9.27 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 1 225126575 260522016 Rat 631843 Bw116 Body weight QTL 116 4.1 0.016 abdominal adipose amount (VT:1000220) abdominal fat pad weight (CMO:0000088) 1 224054293 260122809 Rat 2300175 Bmd40 Bone mineral density QTL 40 15.4 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 1 201554356 246554356 Rat 731175 Uae20 Urinary albumin excretion QTL 20 3.5 0.0018 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 221264111 259647894 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 724538 Kidm1 Kidney mass QTL 1 3.2 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 213707201 252085212 Rat 2293655 Bss36 Bone structure and strength QTL 36 10.66 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 201554356 246554356 Rat 1298084 Thym4 Thymus enlargement QTL 4 10.68 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 197814409 242814409 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 8552891 Epfw5 Epididymal fat weight QTL 5 4.4 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 1 193113876 238113876 Rat 734769 Niddm58 Non-insulin dependent diabetes mellitus QTL 58 body mass (VT:0001259) body weight (CMO:0000012) 1 224569538 260122809 Rat 734768 Niddm59 Non-insulin dependent diabetes mellitus QTL 59 body mass (VT:0001259) body weight (CMO:0000012) 1 213843987 258843987 Rat 1358890 Bp259 Blood pressure QTL 259 3.06 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 210702053 260522016 Rat 724533 Rf51 Renal function QTL 51 5.3 0.0002 kidney plasma flow trait (VT:0005524) renal plasma flow (CMO:0001914) 1 218753816 256448513 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358292 Cm37 Cardiac mass QTL 37 6.2 8e-07 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 1 196248093 241248093 Rat 61376 Bp42 Blood pressure QTL 42 23.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 197814409 242814409 Rat 634313 Niddm43 Non-insulin dependent diabetes mellitus QTL 43 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 199050459 259647894 Rat 1549910 Bw54 Body weight QTL 54 0.05 body mass (VT:0001259) body weight (CMO:0000012) 1 214647894 259647894 Rat 70211 Niddm24 Non-insulin dependent diabetes mellitus QTL 24 3.79 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 214647894 259647894 Rat 1357399 Bw45 Body weight QTL 45 3.05 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 1 206329708 251329708 Rat 724552 Glom2 Glomerulus QTL 2 3.3 0.0001 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 1 222363780 260522016 Rat 1357404 Bw42 Body weight QTL 42 4.49 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 1 206329708 251329708 Rat 10053715 Scort24 Serum corticosterone level QTL 24 2.13 0.0088 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 221414816 260522016 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 1358916 Kidm22 Kidney mass QTL 22 3.32 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 210702053 240947965 Rat 2312564 Glom18 Glomerulus QTL 18 2.4 0.003 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 185356336 231689108 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 61400 Niddm1 Non-insulin dependent diabetes mellitus QTL 1 11 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 218753689 245907899 Rat 10059587 Bw173 Body weight QTL 173 3.23 0.025 body mass (VT:0001259) body weight (CMO:0000012) 1 202069611 247069611 Rat 2292216 Bw80 Body weight QTL 80 3.23 0.0019 body mass (VT:0001259) body weight (CMO:0000012) 1 213533809 243914901 Rat 1300168 Bp170 Blood pressure QTL 170 2.76 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 207702246 228581766 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 10059590 Kidm44 Kidney mass QTL 44 3.42 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 191033875 236033875 Rat 1641926 Teswt2 Testicular weight QTL 2 2.82 testis mass (VT:1000644) both testes wet weight (CMO:0000175) 1 197697768 238755659 Rat 631658 Cm7 Cardiac mass QTL 7 5.32 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 1 196248093 241248093 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 2293700 Bmd27 Bone mineral density QTL 27 6.6 0.0001 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 224054293 243747962 Rat 2293701 Bmd34 Bone mineral density QTL 34 8.3 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 1 224054293 243747962 Rat 7387289 Uae45 Urinary albumin excretion QTL 45 2.86 0.0021 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 223262787 260522016 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 1600374 Mcs17 Mammary carcinoma susceptibility QTL 17 3 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 197670404 242670404 Rat 6480786 Bw97 Body weight QTL 97 5.03 body mass (VT:0001259) body weight (CMO:0000012) 1 225126575 227604520 Rat 1600363 Hc6 Hypercalciuria QTL 6 2.7 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 203995416 244113296 Rat 8693618 Alc25 Alcohol consumption QTL 25 3 0.28 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 1 207987464 228627600 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 2302040 Pia35 Pristane induced arthritis QTL 35 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 216255568 260522016 Rat 7394701 Uae46 Urinary albumin excretion QTL 46 3.6 0.0056 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 201554356 246554356 Rat 1598821 Rf55 Renal function QTL 55 6.3 renal blood flow trait (VT:2000006) ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239) 1 218748008 257976495 Rat
D1Cebr6
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 227,193,527 - 227,193,669 (+) MAPPER mRatBN7.2 Rnor_6.0 1 247,596,785 - 247,596,926 NCBI Rnor6.0 Rnor_5.0 1 254,845,615 - 254,845,756 UniSTS Rnor5.0 RGSC_v3.4 1 233,125,026 - 233,125,167 UniSTS RGSC3.4 Celera 1 224,344,390 - 224,344,531 UniSTS Cytogenetic Map 1 q52 UniSTS
RH141444
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 227,223,455 - 227,223,650 (+) MAPPER mRatBN7.2 Rnor_6.0 1 247,626,712 - 247,626,905 NCBI Rnor6.0 Rnor_5.0 1 254,875,544 - 254,875,737 UniSTS Rnor5.0 RGSC_v3.4 1 233,155,931 - 233,156,124 UniSTS RGSC3.4 Celera 1 224,374,313 - 224,374,506 UniSTS RH 3.4 Map 1 1613.1 UniSTS Cytogenetic Map 1 q52 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
37
59
53
51
21
25
21
6
161
85
39
38
53
30
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000021614 ⟹ ENSRNOP00000021615
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 227,158,941 - 227,223,938 (+) Ensembl Rnor_6.0 Ensembl 1 247,562,202 - 247,627,193 (+) Ensembl
RefSeq Acc Id:
NM_001107582 ⟹ NP_001101052
RefSeq Status:
INFERRED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 236,572,497 - 236,637,490 (+) NCBI mRatBN7.2 1 227,158,941 - 227,223,938 (+) NCBI Rnor_6.0 1 247,562,202 - 247,627,193 (+) NCBI Rnor_5.0 1 254,810,377 - 254,876,025 (+) NCBI RGSC_v3.4 1 233,090,444 - 233,156,412 (+) RGD Celera 1 224,309,877 - 224,374,794 (+) RGD
Sequence:
ACCACATCTTTTGTTCCCCCTTGTTGGTTATATCCTAATGTCAAATGTGGGCATACCTTTGTGGCGCCCCCCTGTCTTCCAACCAGAGGGGATGCACTGGCTGCTCCTGTTGTGGACAGGTTTGGTTG
hide sequence
RefSeq Acc Id:
XM_006231209 ⟹ XP_006231271
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 236,591,384 - 236,637,230 (+) NCBI mRatBN7.2 1 227,177,671 - 227,223,678 (+) NCBI Rnor_6.0 1 247,580,890 - 247,629,279 (+) NCBI Rnor_5.0 1 254,810,377 - 254,876,025 (+) NCBI
Sequence:
GTTCATCCTGCTCTCCAGAAAAGGCCCTGCGAGAAGCAAAAAGAGCAGCTCATTTGAATTCAGAAAGAGTGCCTTCTTCCTCCTTGCTGTGCATAAGCTCTTCTCCAGAAAAGGAACCCACGGGCTCT
hide sequence
RefSeq Acc Id:
XM_039079984 ⟹ XP_038935912
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 236,591,384 - 236,637,230 (+) NCBI mRatBN7.2 1 227,177,696 - 227,223,678 (+) NCBI
RefSeq Acc Id:
XM_039079989 ⟹ XP_038935917
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 236,608,982 - 236,637,230 (+) NCBI mRatBN7.2 1 227,196,023 - 227,223,678 (+) NCBI
RefSeq Acc Id:
NP_001101052 ⟸ NM_001107582
- Peptide Label:
precursor
- UniProtKB:
D4AAV6 (UniProtKB/TrEMBL), A6I0W5 (UniProtKB/TrEMBL)
- Sequence:
MLLLLLILNLSSQLHHIAALFTVTAPKEVYTVDFGSSVSLECDFDRRECTELEGIRASLQKVENDTSSQSQRATLLEELLPLGKASFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYVRIDT
hide sequence
RefSeq Acc Id:
XP_006231271 ⟸ XM_006231209
- Peptide Label:
isoform X1
- UniProtKB:
D4AAV6 (UniProtKB/TrEMBL), A6I0W5 (UniProtKB/TrEMBL)
- Sequence:
MLLLLLILNLSSQLHHIAALFTVTAPKEVYTVDFGSSVSLECDFDRRECTELEGIRASLQKVEN
hide sequence
Ensembl Acc Id:
ENSRNOP00000021615 ⟸ ENSRNOT00000021614
RefSeq Acc Id:
XP_038935912 ⟸ XM_039079984
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038935917 ⟸ XM_039079989
- Peptide Label:
isoform X3
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Pdcd1lg2
programmed cell death 1 ligand 2
Pdcd1lg2_predicted
programmed cell death 1 ligand 2 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Pdcd1lg2_predicted
programmed cell death 1 ligand 2 (predicted)
Symbol and Name status set to approved
70820 APPROVED
