Advanced Search (OLGA)

Gene: Fam133b (family with sequence similarity 133, member B) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Fam133b

Name:

family with sequence similarity 133, member B

RGD ID:

1306302

Description:

Orthologous to several human genes including FAM133B (family with sequence similarity 133 member B); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; cadmium dichloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

hypothetical protein LOC362320; LOC362320; RGD1306302; similar to RIKEN cDNA 5830415L20

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	31,544,458 - 31,571,056 (-)	NCBI		GRCr8
mRatBN7.2	4	30,589,646 - 30,616,291 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	30,589,635 - 30,616,040 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	35,562,476 - 35,588,799 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	31,488,560 - 31,514,883 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	29,884,597 - 29,910,919 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	27,728,883 - 27,755,182 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	27,730,051 - 27,755,103 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	27,632,125 - 27,658,802 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	27,305,922 - 27,332,221 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	27,332,822 - 27,349,419 (-)	NCBI
Celera	4	26,014,093 - 26,040,392 (-)	NCBI		Celera
Cytogenetic Map	4	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fam133b	Rat	pleomorphic xanthoastrocytoma		ISO	FAM133B (Homo sapiens)	8554872	ClinVar Annotator: match by term: Pleomorphic xanthoastrocytoma	ClinVar	PMID:28299358

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fam133b	Rat	1,2-dichloroethane	decreases expression	ISO	Fam133b (Mus musculus)	6480464	ethylene dichloride results in decreased expression of FAM133B mRNA	CTD	PMID:28960355
Fam133b	Rat	1,2-dimethylhydrazine	increases expression	ISO	Fam133b (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of FAM133B mRNA	CTD	PMID:22206623
Fam133b	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of FAM133B mRNA	CTD	PMID:33387578
Fam133b	Rat	2-hydroxypropanoic acid	increases expression	ISO	FAM133B (Homo sapiens)	6480464	Lactic Acid results in increased expression of FAM133B mRNA	CTD	PMID:30851411
Fam133b	Rat	2-methylcholine	affects expression	ISO	FAM133B (Homo sapiens)	6480464	beta-methylcholine affects the expression of FAM133B mRNA	CTD	PMID:21179406
Fam133b	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	FAM133B (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of FAM133B mRNA	CTD	PMID:28628672
Fam133b	Rat	4,4'-sulfonyldiphenol	multiple interactions	ISO	FAM133B (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of FAM133B mRNA	CTD	PMID:28628672
Fam133b	Rat	acrolein	multiple interactions	ISO	FAM133B (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of FAM133B mRNA more ...	CTD	PMID:32699268 and PMID:32845096
Fam133b	Rat	aflatoxin B1	increases expression	ISO	Fam133b (Mus musculus)	6480464	Aflatoxin B1 results in increased expression of FAM133B mRNA	CTD	PMID:19770486
Fam133b	Rat	aflatoxin B1	decreases methylation	ISO	FAM133B (Homo sapiens)	6480464	Aflatoxin B1 results in decreased methylation of FAM133B gene	CTD	PMID:27153756
Fam133b	Rat	aldrin	decreases expression	ISO	Fam133b (Mus musculus)	6480464	Aldrin results in decreased expression of FAM133B mRNA	CTD	PMID:18579281
Fam133b	Rat	alpha-pinene	multiple interactions	ISO	FAM133B (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of FAM133B mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of FAM133B mRNA	CTD	PMID:32699268
Fam133b	Rat	aristolochic acid A	decreases expression	ISO	FAM133B (Homo sapiens)	6480464	aristolochic acid I results in decreased expression of FAM133B mRNA	CTD	PMID:33212167
Fam133b	Rat	arsane	affects methylation	ISO	FAM133B (Homo sapiens)	6480464	Arsenic affects the methylation of FAM133B gene	CTD	PMID:25304211
Fam133b	Rat	arsenic atom	affects methylation	ISO	FAM133B (Homo sapiens)	6480464	Arsenic affects the methylation of FAM133B gene	CTD	PMID:25304211
Fam133b	Rat	benzo[a]pyrene	multiple interactions	ISO	Fam133b (Mus musculus)	6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of FAM133B mRNA	CTD	PMID:27858113
Fam133b	Rat	benzo[a]pyrene diol epoxide I	increases expression	ISO	FAM133B (Homo sapiens)	6480464	7 more ...	CTD	PMID:26238291
Fam133b	Rat	benzo[b]fluoranthene	decreases expression	ISO	Fam133b (Mus musculus)	6480464	benzo(b)fluoranthene results in decreased expression of FAM133B mRNA	CTD	PMID:26377693
Fam133b	Rat	benzo[b]fluoranthene	multiple interactions	ISO	Fam133b (Mus musculus)	6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of FAM133B mRNA	CTD	PMID:27858113
Fam133b	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of FAM133B mRNA	CTD	PMID:25181051
Fam133b	Rat	cadmium dichloride	increases expression	EXP		6480464	Cadmium Chloride results in increased expression of FAM133B mRNA	CTD	PMID:33453195
Fam133b	Rat	chrysene	multiple interactions	ISO	Fam133b (Mus musculus)	6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of FAM133B mRNA	CTD	PMID:27858113
Fam133b	Rat	cisplatin	decreases expression	ISO	FAM133B (Homo sapiens)	6480464	Cisplatin results in decreased expression of FAM133B mRNA	CTD	PMID:27392435
Fam133b	Rat	cisplatin	multiple interactions	ISO	FAM133B (Homo sapiens)	6480464	[Cisplatin co-treated with jinfukang] results in decreased expression of FAM133B mRNA	CTD	PMID:27392435
Fam133b	Rat	cobalt dichloride	increases expression	EXP		6480464	cobaltous chloride results in increased expression of FAM133B mRNA	CTD	PMID:24386269
Fam133b	Rat	cyclosporin A	decreases expression	ISO	Fam133b (Mus musculus)	6480464	Cyclosporine results in decreased expression of FAM133B mRNA	CTD	PMID:25270620
Fam133b	Rat	dexamethasone	multiple interactions	ISO	FAM133B (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of FAM133B mRNA	CTD	PMID:28628672
Fam133b	Rat	diethylstilbestrol	decreases expression	ISO	FAM133B (Homo sapiens)	6480464	Diethylstilbestrol results in decreased expression of FAM133B mRNA	CTD	PMID:36621641
Fam133b	Rat	FR900359	increases phosphorylation	ISO	FAM133B (Homo sapiens)	6480464	FR900359 results in increased phosphorylation of FAM133B protein	CTD	PMID:37730182
Fam133b	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of FAM133B mRNA	CTD	PMID:33387578
Fam133b	Rat	indometacin	multiple interactions	ISO	FAM133B (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of FAM133B mRNA	CTD	PMID:28628672
Fam133b	Rat	nickel subsulfide	increases expression	EXP		6480464	nickel subsulfide results in increased expression of FAM133B mRNA	CTD	PMID:21086188
Fam133b	Rat	ozone	multiple interactions	ISO	FAM133B (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of FAM133B mRNA more ...	CTD	PMID:32699268 and PMID:32845096
Fam133b	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of FAM133B mRNA	CTD	PMID:33387578
Fam133b	Rat	perfluorooctane-1-sulfonic acid	decreases expression	ISO	FAM133B (Homo sapiens)	6480464	perfluorooctane sulfonic acid results in decreased expression of FAM133B mRNA	CTD	PMID:27153767
Fam133b	Rat	rac-lactic acid	increases expression	ISO	FAM133B (Homo sapiens)	6480464	Lactic Acid results in increased expression of FAM133B mRNA	CTD	PMID:30851411
Fam133b	Rat	resveratrol	multiple interactions	ISO	FAM133B (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in increased expression of FAM133B mRNA	CTD	PMID:23557933
Fam133b	Rat	silver atom	increases expression	ISO	Fam133b (Mus musculus)	6480464	Silver results in increased expression of FAM133B mRNA	CTD	PMID:27131904
Fam133b	Rat	silver(0)	increases expression	ISO	Fam133b (Mus musculus)	6480464	Silver results in increased expression of FAM133B mRNA	CTD	PMID:27131904
Fam133b	Rat	sunitinib	increases expression	ISO	FAM133B (Homo sapiens)	6480464	Sunitinib results in increased expression of FAM133B mRNA	CTD	PMID:31533062
Fam133b	Rat	tetrachloromethane	increases expression	EXP		6480464	Carbon Tetrachloride results in increased expression of FAM133B mRNA	CTD	PMID:31150632
Fam133b	Rat	tetrachloromethane	increases expression	ISO	Fam133b (Mus musculus)	6480464	Carbon Tetrachloride results in increased expression of FAM133B mRNA	CTD	PMID:31919559
Fam133b	Rat	tetraphene	multiple interactions	ISO	Fam133b (Mus musculus)	6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of FAM133B mRNA	CTD	PMID:27858113
Fam133b	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of FAM133B mRNA	CTD	PMID:34492290
Fam133b	Rat	thiram	increases expression	ISO	FAM133B (Homo sapiens)	6480464	Thiram results in increased expression of FAM133B mRNA	CTD	PMID:38568856
Fam133b	Rat	Tributyltin oxide	decreases expression	ISO	Fam133b (Mus musculus)	6480464	bis(tri-n-butyltin)oxide results in decreased expression of FAM133B mRNA	CTD	PMID:25270620
Fam133b	Rat	trichostatin A	increases expression	ISO	FAM133B (Homo sapiens)	6480464	trichostatin A results in increased expression of FAM133B mRNA	CTD	PMID:24935251
Fam133b	Rat	triphenyl phosphate	affects expression	ISO	FAM133B (Homo sapiens)	6480464	triphenyl phosphate affects the expression of FAM133B mRNA	CTD	PMID:37042841
Fam133b	Rat	valproic acid	decreases methylation	ISO	FAM133B (Homo sapiens)	6480464	Valproic Acid results in decreased methylation of FAM133B gene	CTD	PMID:29154799
Fam133b	Rat	valproic acid	decreases expression	ISO	FAM133B (Homo sapiens)	6480464	Valproic Acid results in decreased expression of FAM133B mRNA	CTD	PMID:27188386

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
2.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

PMID:22681889

Fam133b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	31,544,458 - 31,571,056 (-)	NCBI		GRCr8
mRatBN7.2	4	30,589,646 - 30,616,291 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	30,589,635 - 30,616,040 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	35,562,476 - 35,588,799 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	31,488,560 - 31,514,883 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	29,884,597 - 29,910,919 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	27,728,883 - 27,755,182 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	27,730,051 - 27,755,103 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	27,632,125 - 27,658,802 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	27,305,922 - 27,332,221 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	27,332,822 - 27,349,419 (-)	NCBI
Celera	4	26,014,093 - 26,040,392 (-)	NCBI		Celera
Cytogenetic Map	4	q13	NCBI

FAM133B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	92,560,758 - 92,590,390 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	92,560,758 - 92,590,393 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	92,190,072 - 92,219,704 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	92,028,008 - 92,057,642 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	7	86,894,604 - 86,924,236 (-)	NCBI		Celera
Cytogenetic Map	7	q21.2	NCBI
HuRef	7	86,799,447 - 86,829,074 (-)	NCBI		HuRef
CHM1_1	7	92,120,110 - 92,149,746 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	93,802,706 - 93,832,343 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	91,519,294 - 91,548,926 (-)	NCBI

Fam133b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	3,593,833 - 3,620,548 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	3,593,833 - 3,620,238 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	3,543,833 - 3,570,548 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	3,543,833 - 3,570,238 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	3,543,833 - 3,570,548 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	3,549,850 - 3,575,817 (+)	NCBI		MGSCv36	mm8
Celera	5	3,479,777 - 3,506,492 (+)	NCBI		Celera
Cytogenetic Map	5	A1	NCBI
cM Map	5	2.22	NCBI

Fam133b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955432	9,484,972 - 9,502,485 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955432	9,484,967 - 9,502,484 (-)	NCBI	ChiLan1.0	ChiLan1.0

FAM133B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	110,446,977 - 110,476,694 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	158,711,686 - 158,741,352 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	84,559,264 - 84,589,085 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	98,154,953 - 98,184,213 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	98,156,201 - 98,184,114 (-)	Ensembl	panpan1.1		panPan2

FAM133B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	14	18,145,882 - 18,168,367 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	30,781,898 - 30,783,509 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
CanFam3.1 Ensembl	14	18,147,576 - 18,168,274 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	14	17,706,754 - 17,729,075 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	17,952,687 - 17,975,186 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	14	17,952,700 - 17,975,143 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	14	18,113,143 - 18,135,428 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	14	17,825,217 - 17,847,483 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	14	18,099,459 - 18,121,970 (-)	NCBI		UU_Cfam_GSD_1.0

Fam133b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	31,533,094 - 31,556,759 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936803	1,243,268 - 1,265,292 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936803	1,243,180 - 1,266,500 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FAM133B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	72,472,338 - 72,503,756 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	9	72,470,990 - 72,503,822 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	79,200,174 - 79,232,806 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FAM133B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	56,420,342 - 56,449,685 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666042	47,830,947 - 47,860,341 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fam133b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624809	597,656 - 640,691 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624809	597,535 - 643,122 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Fam133b
26 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	159
Count of miRNA genes:	118
Interacting mature miRNAs:	137
Transcripts:	ENSRNOT00000012253
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2302371	Stl22	Serum triglyceride level QTL 22	5.15		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5218294	57114705	Rat
2303585	Bw86	Body weight QTL 86	4		body mass (VT:0001259)	body weight (CMO:0000012)	4	14678065	59678065	Rat
8552903	Pigfal2	Plasma insulin-like growth factor 1 level QTL 2	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	4	1	31934116	Rat
9590100	Sffal4	Serum free fatty acids level QTL 4	7.36	0.05	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	4	1	31934116	Rat
8552906	Pigfal3	Plasma insulin-like growth factor 1 level QTL 3			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	4	10084089	55084089	Rat
1357341	Gluco5	Glucose level QTL 5	6.4		adipocyte free fatty acid secretion trait (VT:0010465)	absolute change in adipocyte free fatty acid secretion per unit volume (CMO:0001446)	4	1	33250345	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	26775591	168368347	Rat
1357343	Gluco4	Glucose level QTL 4		0.00002	adipocyte glucose uptake trait (VT:0004185)	adipocyte maximal glucose uptake to basal glucose uptake ratio (CMO:0000874)	4	1	33250345	Rat
6478766	Anxrr47	Anxiety related response QTL 47		0.09637	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	10084089	55084089	Rat
70222	Eae2	Experimental allergic encephalomyelitis QTL 2	4.3		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	4	21333343	39505420	Rat
631642	Stl2	Serum triglyceride level QTL 2	3.3		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5219178	56647776	Rat
6478769	Anxrr48	Anxiety related response QTL 48		0.02514	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	10084089	55084089	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	10814170	91360527	Rat
634323	Hc2	Hypercalciuria QTL 2	2.15		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	4	210796	45210796	Rat
2313401	Anxrr27	Anxiety related response QTL 27			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	4	17933508	62933508	Rat
631209	Bw2	Body weight QTL2	4.2		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	9940885	44463908	Rat
8552803	Bw144	Body weight QTL 144	16		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	4	22710685	34430484	Rat
6909128	Pancm4	Pancreatic morphology QTL 4	11.35		pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	4	26907285	75585128	Rat
8694374	Bw155	Body weight QTL 155	3.39	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	4	10084089	55084089	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
9589046	Scfw2	Subcutaneous fat weight QTL 2	5.54	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	4	1	31934116	Rat
61412	Pia2	Pristane induced arthritis QTL 2	3.9		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	4	21333343	62278020	Rat
6478724	Anxrr35	Anxiety related response QTL 35		0.00449	defecation behavior trait (VT:0010462)	defecation measurement (CMO:0000997)	4	10084089	55084089	Rat
8655906	Rf60	Renal function QTL 60	3.8		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	4	29494195	81006281	Rat
61415	Eae11	Experimental allergic encephalomyelitis QTL 11	2.9		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	4	1	39505420	Rat
619616	Bp79	Blood pressure QTL 79		0.0292	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	5214602	78882945	Rat
7387227	Uae40	Urinary albumin excretion QTL 40	2.9	0.0052	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	17946999	62946999	Rat
6909122	Insul22	Insulin level QTL 22	4.63		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	4	26907285	75585128	Rat
738021	Hcar13	Hepatocarcinoma resistance QTL 13	4.3		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	4	1	32584199	Rat
1358203	Stl19	Serum triglyceride level QTL 19	2.8	0.002	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5218294	65958103	Rat
9590304	Scort17	Serum corticosterone level QTL 17	4.96	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	10084089	55084089	Rat
9589097	Slep11	Serum leptin concentration QTL 11	5.09	0.001	blood leptin amount (VT:0005667)	plasma leptin level (CMO:0000781)	4	1	31934116	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
1354665	Stl10	Serum triglyceride level QTL 10	3.57		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	21333343	44463908	Rat
1300141	Bp178	Blood pressure QTL 178			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	10024901	39524530	Rat

RH140194

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	30,590,044 - 30,590,246 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	27,729,210 - 27,729,411	NCBI	Rnor6.0
Rnor_5.0	4	27,632,524 - 27,632,725	UniSTS	Rnor5.0
RGSC_v3.4	4	27,306,249 - 27,306,450	UniSTS	RGSC3.4
Celera	4	26,014,420 - 26,014,621	UniSTS
Cytogenetic Map	4	q13	UniSTS

BE106498

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	X	10,005,318 - 10,005,468 (+)	MAPPER	mRatBN7.2
Rnor_6.0	X	10,932,293 - 10,932,442	NCBI	Rnor6.0
Rnor_5.0	X	11,730,875 - 11,731,024	UniSTS	Rnor5.0
RGSC_v3.4	X	22,085,321 - 22,085,470	UniSTS	RGSC3.4
Celera	X	10,531,080 - 10,531,229	UniSTS
RH 3.4 Map	X	31.2	UniSTS
Cytogenetic Map	X	q13	UniSTS
Cytogenetic Map	4	q13	UniSTS

RH137530

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	30,590,668 - 30,590,876 (+)	MAPPER	mRatBN7.2
mRatBN7.2	X	10,004,854 - 10,005,062 (+)	MAPPER	mRatBN7.2
Rnor_6.0	X	10,931,828 - 10,932,035	NCBI	Rnor6.0
Rnor_6.0	4	27,729,834 - 27,730,041	NCBI	Rnor6.0
Rnor_5.0	4	27,633,148 - 27,633,355	UniSTS	Rnor5.0
Rnor_5.0	X	11,730,410 - 11,730,617	UniSTS	Rnor5.0
RGSC_v3.4	X	22,084,857 - 22,085,064	UniSTS	RGSC3.4
RGSC_v3.4	4	27,306,873 - 27,307,080	UniSTS	RGSC3.4
Celera	4	26,015,044 - 26,015,251	UniSTS
Celera	X	10,530,616 - 10,530,823	UniSTS
Cytogenetic Map	X	q13	UniSTS
Cytogenetic Map	4	q13	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001024799	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107763	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107764	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107765	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107766	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107767	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063286232	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063286233	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063286234	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC094528	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212464	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229101	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000012253 ⟹ ENSRNOP00000012253

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	30,589,718 - 30,616,016 (-)	Ensembl
Rnor_6.0 Ensembl	4	27,730,051 - 27,755,103 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097111 ⟹ ENSRNOP00000078153

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	30,589,635 - 30,605,018 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000111265 ⟹ ENSRNOP00000090523

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	30,589,848 - 30,616,040 (-)	Ensembl

RefSeq Acc Id:

NM_001024799 ⟹ NP_001019970

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	31,544,458 - 31,570,780 (-)	NCBI
mRatBN7.2	4	30,589,718 - 30,616,046 (-)	NCBI
Rnor_6.0	4	27,728,883 - 27,755,182 (-)	NCBI
Rnor_5.0	4	27,632,125 - 27,658,802 (-)	NCBI
RGSC_v3.4	4	27,305,922 - 27,332,221 (-)	RGD
Celera	4	26,014,093 - 26,040,392 (-)	RGD

Sequence:

show sequence

AGAAGACTTGCGGCGGGCCGCTTCGGCTTCTTCTCCGGCCTGCTTTCCCTGTGGGTTCACGCGCGTTCGGCCGGCCACCATGGGGAAGCGAGACAATCGCGTGGCCTACATGAATCCAATAGCAATGG
CTCGGTCAAGGGGTCCAATCCAGTCTTCAGGACCAACAATCCAGGATTATCTGAATCGACCAAGGCCTACCTGGGAGGAAGTGAAGGAGCAGCTGGAAAAGAAAAAGAAGGGCTCCAAGGCTTTGGCT
GAGTTTGAAGAGAAAATGAATGAGAATTGGAAGAAAGAACTAGAAAAACATAGAGAAAAACTATTAAGTGGAAATGAGAGCTCATCCAAAAAGCGACAGAAAAAGAAAAAAGAAAAGAAGAAATCTGG
TAGGTATTCATCTTCTTCTTCATCGAGCTCTGATTCTTCCAGCAGTTCTTCAGATTCTGAGGAGGAGGATAAAAAGCAAACAAAAAGAAGGAAGAAAAAGAAGAGCCATTGCCATAAGTCTCCGGAGA
CCTCCGTGTCGGATTCAGACTCAGACAGCAAGGATGGTTCAAAAAAGAAAAAGAAGTCAAAGGATATAACTGAAAGAGAAAAGGACACTAAAGGACTCAGCAAAAAGAGAAAGATGTATGAGGATAAA
CCTTTGTCATCTGAGTCATTGTCAGAGTCAGACTGTGGAGAGGTGCAAGCGAAAAAGAAGAAAAGCGGTGAAGAGCGAGAGAGAACAACAGACAAAGCTAAAAAGAGAAGGAAGCATAAGAAACACAG
CAAGAAGAAGAAAAAGAAGGCTGCCAGTTCAAGCTCAGACTCGCCGTAGCATCCAGAAGACCAGGGTCCTTACAGAGTGCAATGTCAAAGGAGCTCTCAACTGTGAAGATTATGACTTACTTAGTAAC
GTGCATGAATCCCCTTGTTTTTAGACTTGTCCTGGACTAGTCAGTAGTCACTTGGATTCCGCTGTGTGAAGGGCCATGAATGTTGCCTGCTGCTTGAACACCTTTTCCTCTTCCAGTGCTTGGTGACT
CTGGGAGATAGTACTTTGCAGTCATACTAGTGGTTAAGATATTTGGAATAAAGCTAATATTTTTTACTAGAAGTACTTAAGAATAAATCAACAGGAACTGAATCTGGATCCATCTTTTAAGATGTAAC
CAGAAATAACGAGATGACTCTAGTAAAGATTTTCAAAGTAGGGACTTCATTAATATTTCAAAATCCTTACTCTGTAGATAAGTATATTTTAATTTTTCCCCACGTATGCTTTGATTTACTTGGGGAAG
GAGCTTTTAAAGAGGGGGTGGTTTGCTATCTCTTTAGCTACCAGAACAGCGTGCCTTTGATCTCACACATCCTACTTTTGTGGACACAGTAGCCATGCTTCCTGGGAGGACAGAGCTGGGCACGGTCA
GTCCTGCCCTGACTGAGGTTAATGACATCCTTAGACTTTGTCGTATGCTGCTTGGAATGAACCAGAGGTACCCGGCCCTTTGCAGCATGAGAAAGCCCCCAAAGCTCTGGAATTACCTCCACATCAAT
AATAACTGAATGTTTTTAGGGTTACGTTGTGTTGCGTCATTTGAATTCATTTTGACTACACTTTGGCTTTGGAGAGGGATGGTTTAGTAGACACTGGTACTTTCTGAGCTTGACAGCTGACAGTTGTA
AAGCGCATGTGTTACACAAGTTTTAACCAGTCAGGAGATTTCTACGTAGCCAGTGATAGACACTTCATGTTTTGTATAAACTTTGTTTAGGCTGCAGTGTTTAGCTTTTAACTAACTCTTGCTGTCTT
AAGTTCATAACTATGTTTAATGGCACACTTTCAAGATATTTAGCATGTAAAAAGCAGGACTTTTGGTTTTTGTTTTTAACGGCTTCATATTGAAGCTGAGACTTACCACAAACAAGTTGAGTGGCAGG
CCTGGTATGCTGTATCTTGTTACATAAAGCTATTGCCAGAATCTTAGTAAACACTTGTTTTAAAAAAAAAAAAAAAAAAAAAAAAAAGG

hide sequence

RefSeq Acc Id:

XM_039107763 ⟹ XP_038963691

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	31,544,458 - 31,571,056 (-)	NCBI
mRatBN7.2	4	30,589,646 - 30,616,159 (-)	NCBI

RefSeq Acc Id:

XM_039107764 ⟹ XP_038963692

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	31,544,458 - 31,556,514 (-)	NCBI
mRatBN7.2	4	30,589,646 - 30,616,183 (-)	NCBI

RefSeq Acc Id:

XM_039107765 ⟹ XP_038963693

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	31,544,458 - 31,556,514 (-)	NCBI
mRatBN7.2	4	30,589,646 - 30,616,179 (-)	NCBI

RefSeq Acc Id:

XM_039107766 ⟹ XP_038963694

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	31,544,458 - 31,556,514 (-)	NCBI
mRatBN7.2	4	30,589,718 - 30,616,291 (-)	NCBI

RefSeq Acc Id:

XM_039107767 ⟹ XP_038963695

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	31,544,458 - 31,556,514 (-)	NCBI
mRatBN7.2	4	30,589,718 - 30,616,286 (-)	NCBI

RefSeq Acc Id:

XM_063286232 ⟹ XP_063142302

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	31,544,458 - 31,570,623 (-)	NCBI

RefSeq Acc Id:

XM_063286233 ⟹ XP_063142303

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	31,544,458 - 31,571,056 (-)	NCBI

RefSeq Acc Id:

XM_063286234 ⟹ XP_063142304

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	31,544,458 - 31,571,056 (-)	NCBI


Protein RefSeqs	NP_001019970	(Get FASTA)	NCBI Sequence Viewer
	XP_038963691	(Get FASTA)	NCBI Sequence Viewer
	XP_038963692	(Get FASTA)	NCBI Sequence Viewer
	XP_038963693	(Get FASTA)	NCBI Sequence Viewer
	XP_038963694	(Get FASTA)	NCBI Sequence Viewer
	XP_038963695	(Get FASTA)	NCBI Sequence Viewer
	XP_063142302	(Get FASTA)	NCBI Sequence Viewer
	XP_063142303	(Get FASTA)	NCBI Sequence Viewer
	XP_063142304	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH94528	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000012253
	ENSRNOP00000090523
GenBank Protein	Q505I5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001019970 ⟸ NM_001024799

- UniProtKB:

Q505I5 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MGKRDNRVAYMNPIAMARSRGPIQSSGPTIQDYLNRPRPTWEEVKEQLEKKKKGSKALAEFEEKMNENWKKELEKHREKLLSGNESSSKKRQKKKKEKKKSGRYSSSSSSSSDSSSSSSDSEEEDKKQ
TKRRKKKKSHCHKSPETSVSDSDSDSKDGSKKKKKSKDITEREKDTKGLSKKRKMYEDKPLSSESLSESDCGEVQAKKKKSGEERERTTDKAKKRRKHKKHSKKKKKKAASSSSDSP

hide sequence

Ensembl Acc Id:

ENSRNOP00000012253 ⟸ ENSRNOT00000012253

RefSeq Acc Id:	XP_038963692 ⟸ XM_039107764
- Peptide Label:	isoform X5

RefSeq Acc Id:	XP_038963693 ⟸ XM_039107765
- Peptide Label:	isoform X6

RefSeq Acc Id:	XP_038963691 ⟸ XM_039107763
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I6ANF8 (UniProtKB/TrEMBL)

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q505I5-F1-model_v2	AlphaFold	Q505I5	1-245	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13692851

Promoter ID:

EPDNEW_R3375

Type:

initiation region

Name:

Fam133b_1

Description:

family with sequence similarity 133, member B

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	27,755,150 - 27,755,210	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-45760	BioCyc
Ensembl Genes	ENSRNOG00000009163	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000012253	ENTREZGENE
	ENSRNOT00000111265	ENTREZGENE
IMAGE_CLONE	IMAGE:7320019	IMAGE-MGC_LOAD
InterPro	Fam133	UniProtKB/Swiss-Prot
KEGG Report	rno:362320	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105633	IMAGE-MGC_LOAD
NCBI Gene	362320	ENTREZGENE
PANTHER	PROTEIN FAM133B	UniProtKB/Swiss-Prot
	PTHR31911	UniProtKB/Swiss-Prot
PhenoGen	Fam133b	PhenoGen
RatGTEx	ENSRNOG00000009163	RatGTEx
UniProt	A0A8I5ZJP5_RAT	UniProtKB/TrEMBL
	A0A8I6ANF8	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2Q616_RAT	UniProtKB/TrEMBL
	A6K289	ENTREZGENE, UniProtKB/TrEMBL
	F133B_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-07	Fam133b	family with sequence similarity 133, member B	RGD1306302	similar to RIKEN cDNA 5830415L20	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1306302	similar to RIKEN cDNA 5830415L20	RGD1306302_predicted	similar to RIKEN cDNA 5830415L20 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1306302_predicted	similar to RIKEN cDNA 5830415L20 (predicted)	LOC362320_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC362320_predicted	similar to RIKEN cDNA 5830415L20 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar