Symbol:
Mnda
Name:
myeloid cell nuclear differentiation antigen
RGD ID:
1306089
Description:
Predicted to enable double-stranded DNA binding activity and transcription coregulator activity. Predicted to be involved in several processes, including activation of immune response; cellular response to cytokine stimulus; and negative regulation of B cell proliferation. Predicted to act upstream of or within several processes, including inner ear development; positive regulation of osteoblast differentiation; and regulation of transcription by RNA polymerase II. Predicted to be located in nuclear inclusion body; nuclear periphery; and nuclear speck. Predicted to be active in cytosol; nucleolus; and nucleoplasm. Orthologous to several human genes including MNDA (myeloid cell nuclear differentiation antigen); INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 17beta-estradiol 3-benzoate.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Ifi204; interferon activated gene 204; LOC304988; rHin-3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 88,550,224 - 88,567,892 (-) NCBI GRCr8 mRatBN7.2 13 86,017,888 - 86,035,556 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 86,017,892 - 86,034,201 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 88,525,833 - 88,543,479 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 89,926,105 - 89,943,751 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 87,110,842 - 87,128,488 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 92,073,664 - 92,091,335 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 92,073,668 - 92,089,980 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 96,545,815 - 96,606,181 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 89,752,997 - 89,770,167 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 89,941,881 - 89,959,051 (-) NCBI Celera 13 85,620,545 - 85,638,000 (-) NCBI Celera Cytogenetic Map 13 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mnda Rat 1,2-dichloroethane decreases expression ISO Ifi204 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of IFI204 mRNA CTD PMID:28960355 Mnda Rat 1,2-dichloroethane decreases expression ISO Ifi211 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of PYHIN1 mRNA CTD PMID:28960355 Mnda Rat 1,2-dimethylhydrazine increases expression ISO Ifi204 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of IFI204 mRNA CTD PMID:22206623 Mnda Rat 1,2-dimethylhydrazine multiple interactions ISO Ifi204 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of IFI204 mRNA CTD PMID:22206623 Mnda Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of IFI204 mRNA CTD PMID:25380136 Mnda Rat 17beta-estradiol increases expression ISO Ifi204 (Mus musculus) 6480464 Estradiol results in increased expression of IFI204 mRNA CTD PMID:19484750 Mnda Rat 17beta-estradiol decreases expression ISO Ifi211 (Mus musculus) 6480464 Estradiol results in decreased expression of IFI211 mRNA CTD PMID:39298647 Mnda Rat 17beta-estradiol decreases expression ISO Ifi204 (Mus musculus) 6480464 Estradiol results in decreased expression of IFI204 mRNA CTD PMID:39298647 Mnda Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of MNDA mRNA CTD PMID:32741896 Mnda Rat 17beta-estradiol 3-benzoate increases expression EXP 6480464 estradiol 3-benzoate results in increased expression of MNDA mRNA CTD PMID:32741896 Mnda Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of MNDA mRNA CTD PMID:32741896 Mnda Rat 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO Ifi204 (Mus musculus) 6480464 [Flame Retardants results in increased abundance of 2 more ... CTD PMID:38995820 Mnda Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Ifi204 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of IFI204 mRNA CTD PMID:21041162 Mnda Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ifi211 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PYHIN1 mRNA CTD PMID:26377647 Mnda Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of MNDA mRNA CTD PMID:33387578 Mnda Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MNDA mRNA CTD PMID:34747641 Mnda Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Ifi211 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of MNDA mRNA CTD PMID:26290441 Mnda Rat 2,4,6-trinitrobenzenesulfonic acid increases expression ISO Ifi204 (Mus musculus) 6480464 Trinitrobenzenesulfonic Acid results in increased expression of IFI204 mRNA CTD PMID:17982090 Mnda Rat 2,4,6-trinitrobenzenesulfonic acid increases expression ISO Ifi211 (Mus musculus) 6480464 Trinitrobenzenesulfonic Acid results in increased expression of MNDA mRNA CTD PMID:17982090 Mnda Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Ifi211 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Mnda Rat 2-amino-2-deoxy-D-glucopyranose increases expression ISO Ifi204 (Mus musculus) 6480464 Glucosamine results in increased expression of IFI204 mRNA CTD PMID:17178593 Mnda Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Ifi204 (Mus musculus) 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in increased expression of IFI204 mRNA CTD PMID:16054899 Mnda Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of IFI204 mRNA CTD PMID:25380136 Mnda Rat 4,4'-diaminodiphenylmethane affects expression ISO Ifi204 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane affects the expression of IFI16 mRNA CTD PMID:18648102 Mnda Rat 4,4'-sulfonyldiphenol decreases expression ISO Ifi204 (Mus musculus) 6480464 bisphenol S results in decreased expression of IFI204 mRNA CTD PMID:39298647 Mnda Rat 4-hydroxynon-2-enal decreases expression ISO Ifi204 (Mus musculus) 6480464 4-hydroxy-2-nonenal results in decreased expression of IFI16 mRNA and 4-hydroxy-2-nonenal results in decreased expression of IFI204 mRNA CTD PMID:19191707 Mnda Rat 4-hydroxynon-2-enal decreases expression ISO MNDA (Homo sapiens) 6480464 4-hydroxy-2-nonenal results in decreased expression of MNDA mRNA CTD PMID:12419474 Mnda Rat 4-hydroxyphenyl retinamide decreases expression ISO Ifi204 (Mus musculus) 6480464 Fenretinide results in decreased expression of IFI16 mRNA CTD PMID:28973697 Mnda Rat 4-hydroxyphenyl retinamide increases expression ISO Ifi204 (Mus musculus) 6480464 Fenretinide results in increased expression of IFI16 mRNA and Fenretinide results in increased expression of IFI204 mRNA CTD PMID:16467112 and PMID:28973697 Mnda Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of MNDA mRNA CTD PMID:31881176 Mnda Rat aldehydo-D-glucosamine increases expression ISO Ifi204 (Mus musculus) 6480464 Glucosamine results in increased expression of IFI204 mRNA CTD PMID:17178593 Mnda Rat aldehydo-D-glucose multiple interactions ISO Ifi204 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of IFI204 mRNA CTD PMID:37567420 Mnda Rat all-trans-retinoic acid increases expression ISO MNDA (Homo sapiens) 6480464 Tretinoin results in increased expression of MNDA mRNA CTD PMID:17218384 and PMID:33167477 Mnda Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of IFI204 mRNA CTD PMID:30779732 Mnda Rat antirheumatic drug decreases expression ISO MNDA (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of MNDA mRNA CTD PMID:24449571 Mnda Rat Azoxymethane multiple interactions ISO Ifi204 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of IFI204 mRNA CTD PMID:29950665 Mnda Rat benzo[a]pyrene decreases expression ISO MNDA (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of MNDA mRNA CTD PMID:20064835 Mnda Rat benzo[a]pyrene decreases expression ISO Ifi211 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of PYHIN1 mRNA CTD PMID:21569818 Mnda Rat benzo[b]fluoranthene increases expression ISO Ifi211 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of PYHIN1 mRNA CTD PMID:26377693 Mnda Rat beta-D-glucosamine increases expression ISO Ifi204 (Mus musculus) 6480464 Glucosamine results in increased expression of IFI204 mRNA CTD PMID:17178593 Mnda Rat bis(2-chloroethyl) sulfide increases expression ISO Ifi204 (Mus musculus) 6480464 Mustard Gas results in increased expression of IFI204 mRNA CTD PMID:15674844 Mnda Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of MNDA mRNA CTD PMID:25181051 Mnda Rat bisphenol A decreases expression ISO Ifi204 (Mus musculus) 6480464 bisphenol A results in decreased expression of IFI204 mRNA CTD PMID:33221593 Mnda Rat buta-1,3-diene decreases expression ISO Ifi211 (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of PYHIN1 mRNA CTD PMID:29038090 Mnda Rat cadmium atom multiple interactions ISO MNDA (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of MNDA mRNA CTD PMID:35301059 Mnda Rat cadmium dichloride multiple interactions ISO MNDA (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of MNDA mRNA CTD PMID:35301059 Mnda Rat caffeine increases phosphorylation ISO MNDA (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of MNDA protein CTD PMID:35688186 Mnda Rat cantharidin decreases expression ISO Ifi211 (Mus musculus) 6480464 Cantharidin results in decreased expression of IFI211 mRNA CTD PMID:36907384 Mnda Rat carbon nanotube increases expression ISO Ifi211 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Mnda Rat carbon nanotube affects expression ISO Ifi211 (Mus musculus) 6480464 Nanotubes and Carbon analog affects the expression of PYHIN1 mRNA CTD PMID:25554681 Mnda Rat carbon nanotube increases expression ISO Ifi204 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Mnda Rat carbon nanotube decreases expression ISO Ifi211 (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of MNDA mRNA CTD PMID:25620056 Mnda Rat chlordecone multiple interactions ISO Ifi204 (Mus musculus) 6480464 Chlordecone promotes the reaction [Biomarkers metabolite binds to IFI204 gene] CTD PMID:31084621 Mnda Rat chlordecone multiple interactions ISO Ifi211 (Mus musculus) 6480464 Chlordecone promotes the reaction [Biomarkers metabolite binds to MNDA gene] CTD PMID:31084621 Mnda Rat chloroprene decreases expression ISO Ifi211 (Mus musculus) 6480464 Chloroprene results in decreased expression of PYHIN1 mRNA CTD PMID:23125180 Mnda Rat chlorpyrifos increases expression ISO Ifi204 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of IFI204 mRNA CTD PMID:32715474 Mnda Rat cisplatin increases expression ISO Ifi204 (Mus musculus) 6480464 Cisplatin results in increased expression of IFI16 mRNA CTD PMID:21151649 Mnda Rat clofibrate multiple interactions ISO Ifi211 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of MNDA mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of MNDA mRNA] CTD PMID:17585979 Mnda Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of IFI204 mRNA CTD PMID:30556269 Mnda Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of IFI204 mRNA CTD PMID:30556269 Mnda Rat cyclophosphamide increases expression ISO Ifi204 (Mus musculus) 6480464 Cyclophosphamide results in increased expression of IFI204 mRNA CTD PMID:21041162 Mnda Rat D-glucose multiple interactions ISO Ifi204 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of IFI204 mRNA CTD PMID:37567420 Mnda Rat dexamethasone multiple interactions ISO Ifi204 (Mus musculus) 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in increased expression of IFI204 mRNA CTD PMID:16054899 Mnda Rat dexamethasone increases expression ISO Ifi204 (Mus musculus) 6480464 Dexamethasone results in increased expression of IFI204 mRNA CTD PMID:21041162 Mnda Rat dextran sulfate multiple interactions ISO Ifi204 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of IFI204 mRNA CTD PMID:29950665 Mnda Rat dextran sulfate increases expression ISO Ifi211 (Mus musculus) 6480464 Dextran Sulfate results in increased expression of PYHIN1 mRNA CTD PMID:23894361 Mnda Rat Dibutyl phosphate affects expression ISO MNDA (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of MNDA mRNA CTD PMID:37042841 Mnda Rat dichlorine increases expression ISO Ifi204 (Mus musculus) 6480464 Chlorine results in increased expression of IFI204 mRNA CTD PMID:30189237 Mnda Rat diclofenac increases expression ISO Ifi211 (Mus musculus) 6480464 Diclofenac results in increased expression of MNDA mRNA CTD PMID:26934552 Mnda Rat diethylstilbestrol increases expression ISO Ifi204 (Mus musculus) 6480464 Diethylstilbestrol results in increased expression of IFI204 mRNA CTD PMID:21041162 Mnda Rat dioxygen multiple interactions ISO Ifi211 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of PYHIN1 mRNA CTD PMID:30529165 Mnda Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of MNDA mRNA CTD PMID:29391264 Mnda Rat epoxiconazole increases expression ISO Ifi211 (Mus musculus) 6480464 epoxiconazole results in increased expression of IFI211 mRNA CTD PMID:35436446 Mnda Rat ferric oxide increases expression EXP 6480464 ferric oxide analog results in increased expression of MNDA mRNA CTD PMID:38615722 Mnda Rat fluoranthene multiple interactions ISO Ifi204 (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in increased expression of IFI204 mRNA CTD PMID:28329830 Mnda Rat fluoranthene multiple interactions ISO Ifi211 (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in increased expression of MNDA mRNA CTD PMID:28329830 Mnda Rat folic acid affects expression ISO Ifi204 (Mus musculus) 6480464 Folic Acid deficiency affects the expression of IFI204 mRNA CTD PMID:32304770 Mnda Rat folic acid multiple interactions ISO Ifi204 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of IFI204 mRNA CTD PMID:22206623 Mnda Rat fructose multiple interactions ISO Ifi204 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of IFI204 mRNA CTD PMID:37567420 Mnda Rat furan increases expression EXP 6480464 furan results in increased expression of IFI204 mRNA CTD PMID:27387713 Mnda Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of MNDA mRNA CTD PMID:22061828 and PMID:33387578 Mnda Rat glucose multiple interactions ISO Ifi204 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of IFI204 mRNA CTD PMID:37567420 Mnda Rat glyphosate multiple interactions ISO Ifi204 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of IFI204 mRNA CTD PMID:37567420 Mnda Rat Indeno[1,2,3-cd]pyrene decreases expression ISO Ifi211 (Mus musculus) 6480464 indeno(1 more ... CTD PMID:26377693 Mnda Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of IFI204 mRNA CTD PMID:21396975 Mnda Rat lidocaine increases expression EXP 6480464 Lidocaine results in increased expression of PYHIN1 mRNA CTD PMID:35283115 Mnda Rat lipopolysaccharide affects expression ISO Ifi204 (Mus musculus) 6480464 Lipopolysaccharides affects the expression of IFI204 mRNA CTD PMID:24056979 Mnda Rat lipopolysaccharide multiple interactions ISO MNDA (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Mnda Rat lipopolysaccharide multiple interactions ISO Ifi204 (Mus musculus) 6480464 methyldithiocarbamate inhibits the reaction [Lipopolysaccharides affects the expression of IFI204 mRNA] CTD PMID:24056979 Mnda Rat lipopolysaccharide increases expression ISO Ifi204 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of IFI204 mRNA CTD PMID:25890327 and PMID:26582142 Mnda Rat manganese(II) chloride decreases expression EXP 6480464 manganese chloride results in decreased expression of IFI204 mRNA CTD PMID:28801915 Mnda Rat metam multiple interactions ISO Ifi204 (Mus musculus) 6480464 methyldithiocarbamate inhibits the reaction [Lipopolysaccharides affects the expression of IFI204 mRNA] CTD PMID:24056979 Mnda Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of IFI204 mRNA CTD PMID:25380136 Mnda Rat nickel atom decreases expression ISO MNDA (Homo sapiens) 6480464 Nickel results in decreased expression of MNDA mRNA CTD PMID:23195993 Mnda Rat nickel atom increases expression ISO MNDA (Homo sapiens) 6480464 Nickel results in increased expression of MNDA mRNA CTD PMID:24768652 and PMID:25583101 Mnda Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of MNDA mRNA CTD PMID:33484710 Mnda Rat nonanoic acid increases expression ISO Ifi204 (Mus musculus) 6480464 pelargonic acid results in increased expression of IFI204 mRNA CTD PMID:11379042 Mnda Rat oxaliplatin decreases expression EXP 6480464 oxaliplatin results in decreased expression of MNDA mRNA CTD PMID:25729387 Mnda Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of MNDA mRNA CTD PMID:25729387 Mnda Rat ozone decreases expression ISO Ifi211 (Mus musculus) 6480464 Ozone results in decreased expression of MNDA mRNA and Ozone results in decreased expression of PYHIN1 mRNA CTD PMID:16183385 and PMID:33026818 Mnda Rat ozone multiple interactions ISO MNDA (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of MNDA mRNA CTD PMID:35430440 Mnda Rat ozone decreases expression ISO Ifi204 (Mus musculus) 6480464 Ozone results in decreased expression of IFI204 mRNA CTD PMID:33026818 Mnda Rat ozone multiple interactions ISO Ifi204 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of IFI204 mRNA CTD PMID:34911549 Mnda Rat paracetamol affects expression ISO Ifi204 (Mus musculus) 6480464 Acetaminophen affects the expression of IFI204 mRNA CTD PMID:17562736 Mnda Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of MNDA mRNA CTD PMID:33387578 Mnda Rat paracetamol multiple interactions ISO Ifi211 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of MNDA mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of MNDA mRNA] CTD PMID:17585979 Mnda Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of MNDA mRNA CTD PMID:32680482 Mnda Rat pentachlorophenol increases expression ISO Ifi204 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of IFI204 mRNA CTD PMID:23892564 Mnda Rat pentachlorophenol increases expression ISO Ifi211 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of PYHIN1 mRNA CTD PMID:23892564 Mnda Rat perfluorooctanoic acid increases expression ISO Ifi211 (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of IFI211 mRNA CTD PMID:30711707 Mnda Rat pirinixic acid decreases expression ISO Ifi204 (Mus musculus) 6480464 pirinixic acid results in decreased expression of IFI204 mRNA CTD PMID:18445702 Mnda Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO MNDA (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Mnda Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO MNDA (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of MNDA mRNA CTD PMID:35811015 Mnda Rat serpentine asbestos decreases expression ISO MNDA (Homo sapiens) 6480464 Asbestos and Serpentine results in decreased expression of MNDA mRNA CTD PMID:21148743 Mnda Rat silicon dioxide increases expression ISO Ifi211 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of MNDA mRNA CTD PMID:29341224 Mnda Rat silicon dioxide increases expression ISO Ifi204 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of IFI204 mRNA CTD PMID:29341224 Mnda Rat silver atom decreases expression ISO Ifi204 (Mus musculus) 6480464 Silver results in decreased expression of IFI204 mRNA CTD PMID:27131904 Mnda Rat silver atom affects expression ISO Ifi211 (Mus musculus) 6480464 Silver affects the expression of PYHIN1 mRNA CTD PMID:27131904 Mnda Rat silver(0) decreases expression ISO Ifi204 (Mus musculus) 6480464 Silver results in decreased expression of IFI204 mRNA CTD PMID:27131904 Mnda Rat silver(0) affects expression ISO Ifi211 (Mus musculus) 6480464 Silver affects the expression of PYHIN1 mRNA CTD PMID:27131904 Mnda Rat sodium arsenite decreases expression ISO Ifi211 (Mus musculus) 6480464 sodium arsenite results in decreased expression of IFI211 mRNA CTD PMID:37682722 Mnda Rat succimer multiple interactions ISO Ifi211 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in increased expression of MNDA mRNA CTD PMID:21641980 Mnda Rat sulforaphane increases expression ISO MNDA (Homo sapiens) 6480464 sulforaphane results in increased expression of MNDA mRNA CTD PMID:26833863 Mnda Rat tamoxifen affects expression ISO Ifi211 (Mus musculus) 6480464 Tamoxifen affects the expression of PYHIN1 mRNA CTD PMID:20937368 Mnda Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of MNDA mRNA CTD PMID:32741896 Mnda Rat tetrachloromethane affects expression ISO Ifi204 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of IFI204 mRNA CTD PMID:17484886 Mnda Rat tetrachloromethane increases expression ISO Ifi211 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of PYHIN1 mRNA CTD PMID:27339419 Mnda Rat tetrachloromethane increases expression ISO Ifi204 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of IFI204 mRNA CTD PMID:29987408 and PMID:31919559 Mnda Rat tetraphene decreases expression ISO Ifi211 (Mus musculus) 6480464 benz(a)anthracene results in decreased expression of MNDA mRNA CTD PMID:26377693 Mnda Rat tetrathiomolybdate(2-) increases expression ISO MNDA (Homo sapiens) 6480464 tetrathiomolybdate results in increased expression of MNDA mRNA CTD PMID:37290678 Mnda Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of MNDA mRNA CTD PMID:34492290 Mnda Rat titanium dioxide increases expression ISO Ifi204 (Mus musculus) 6480464 titanium dioxide results in increased expression of IFI204 mRNA CTD PMID:23557971 Mnda Rat titanium dioxide multiple interactions ISO Ifi204 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of IFI204 mRNA CTD PMID:29950665 Mnda Rat titanium dioxide increases expression ISO Ifi211 (Mus musculus) 6480464 titanium dioxide results in increased expression of IFI211 mRNA and titanium dioxide results in increased expression of PYHIN1 mRNA CTD PMID:23557971 and PMID:27760801 Mnda Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of MNDA mRNA CTD PMID:25729387 Mnda Rat tremolite asbestos increases expression ISO Ifi211 (Mus musculus) 6480464 tremolite results in increased expression of IFI211 mRNA CTD PMID:29279043 Mnda Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of MNDA mRNA CTD PMID:33387578 Mnda Rat triphenyl phosphate affects expression ISO MNDA (Homo sapiens) 6480464 triphenyl phosphate affects the expression of MNDA mRNA CTD PMID:37042841 Mnda Rat trovafloxacin increases expression ISO Ifi211 (Mus musculus) 6480464 trovafloxacin results in increased expression of MNDA mRNA and trovafloxacin results in increased expression of PYHIN1 mRNA CTD PMID:35537566 Mnda Rat valproic acid affects expression ISO Ifi204 (Mus musculus) 6480464 Valproic Acid affects the expression of IFI16 mRNA CTD PMID:17292431 Mnda Rat zidovudine multiple interactions ISO MNDA (Homo sapiens) 6480464 [Zidovudine co-treated with IFNA1 protein] results in increased expression of MNDA mRNA CTD PMID:20370541
1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrobenzenesulfonic acid (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-amino-2-deoxy-D-glucopyranose (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (EXP,ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (ISO) 4-hydroxyphenyl retinamide (ISO) acetamide (EXP) aldehydo-D-glucosamine (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) amphetamine (EXP) antirheumatic drug (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) beta-D-glucosamine (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) buta-1,3-diene (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) cantharidin (ISO) carbon nanotube (ISO) chlordecone (ISO) chloroprene (ISO) chlorpyrifos (ISO) cisplatin (ISO) clofibrate (ISO) copper atom (EXP) copper(0) (EXP) cyclophosphamide (ISO) D-glucose (ISO) dexamethasone (ISO) dextran sulfate (ISO) Dibutyl phosphate (ISO) dichlorine (ISO) diclofenac (ISO) diethylstilbestrol (ISO) dioxygen (ISO) endosulfan (EXP) epoxiconazole (ISO) ferric oxide (EXP) fluoranthene (ISO) folic acid (ISO) fructose (ISO) furan (EXP) gentamycin (EXP) glucose (ISO) glyphosate (ISO) Indeno[1,2,3-cd]pyrene (ISO) indole-3-methanol (EXP) lidocaine (EXP) lipopolysaccharide (ISO) manganese(II) chloride (EXP) metam (ISO) N-nitrosodimethylamine (EXP) nickel atom (ISO) nitrofen (EXP) nonanoic acid (ISO) oxaliplatin (EXP) ozone (ISO) paracetamol (EXP,ISO) paraquat (EXP) pentachlorophenol (ISO) perfluorooctanoic acid (ISO) pirinixic acid (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) serpentine asbestos (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) succimer (ISO) sulforaphane (ISO) tamoxifen (ISO) testosterone (EXP) tetrachloromethane (ISO) tetraphene (ISO) tetrathiomolybdate(2-) (ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) tremolite asbestos (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) trovafloxacin (ISO) valproic acid (ISO) zidovudine (ISO)
Mnda (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 88,550,224 - 88,567,892 (-) NCBI GRCr8 mRatBN7.2 13 86,017,888 - 86,035,556 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 86,017,892 - 86,034,201 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 88,525,833 - 88,543,479 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 89,926,105 - 89,943,751 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 87,110,842 - 87,128,488 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 92,073,664 - 92,091,335 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 92,073,668 - 92,089,980 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 96,545,815 - 96,606,181 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 89,752,997 - 89,770,167 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 89,941,881 - 89,959,051 (-) NCBI Celera 13 85,620,545 - 85,638,000 (-) NCBI Celera Cytogenetic Map 13 q24 NCBI
MNDA (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 158,831,351 - 158,849,502 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 158,831,351 - 158,849,506 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 158,801,141 - 158,819,292 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 157,067,792 - 157,085,894 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 155,614,240 - 155,632,343 NCBI Celera 1 131,871,536 - 131,889,615 (+) NCBI Celera Cytogenetic Map 1 q23.1 NCBI HuRef 1 130,158,445 - 130,176,628 (+) NCBI HuRef CHM1_1 1 160,197,828 - 160,215,889 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 157,968,444 - 157,986,571 (+) NCBI T2T-CHM13v2.0
Ifi211 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 173,723,907 - 173,740,650 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 173,723,911 - 173,740,612 (-) Ensembl GRCm39 Ensembl GRCm38 1 173,896,339 - 173,913,087 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 173,896,345 - 173,913,046 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 175,826,486 - 175,843,053 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 175,733,030 - 175,749,597 (-) NCBI MGSCv36 mm8 Cytogenetic Map 1 H3 NCBI cM Map 1 80.74 NCBI
Ifi204 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 173,574,859 - 173,594,606 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 173,574,859 - 173,594,509 (-) Ensembl GRCm39 Ensembl GRCm38 1 173,747,293 - 173,767,069 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 173,747,293 - 173,766,943 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 175,677,424 - 175,697,050 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 175,583,971 - 175,603,592 (-) NCBI MGSCv36 mm8 Celera 1 176,611,290 - 176,630,307 (-) NCBI Celera Cytogenetic Map 1 H3 NCBI cM Map 1 80.63 NCBI
MNDA (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 90,997,756 - 91,015,719 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 90,741,647 - 90,759,598 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 134,190,768 - 134,208,723 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 137,981,896 - 137,999,850 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 137,992,523 - 137,999,587 (+) Ensembl panpan1.1 panPan2
LOC488622 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 38 22,874,345 - 22,892,362 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 38 22,889,707 - 22,929,512 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 38 22,999,619 - 23,039,476 (-) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 38 22,763,164 - 22,802,846 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 38 23,298,079 - 23,337,779 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 38 23,728,891 - 23,768,811 (-) NCBI UU_Cfam_GSD_1.0
MNDA (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 5,079,633 - 5,124,967 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 5,079,632 - 5,095,868 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 4,226,792 - 4,271,918 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
.
Predicted Target Of
Count of predictions: 199 Count of miRNA genes: 129 Interacting mature miRNAs: 140 Transcripts: ENSRNOT00000036040 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
7207885 Glom27 Glomerulus QTL 27 3.9 kidney glomerulus integrity trait (VT:0010546) kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139) 13 20605871 101339738 Rat 7387280 Uae43 Urinary albumin excretion QTL 43 5.69 0.4174 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 66451204 106807694 Rat 1298066 Bp159 Blood pressure QTL 159 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 46088046 91088046 Rat 10755495 Bp387 Blood pressure QTL 387 3.78 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34663461 87525369 Rat 70181 BpQTLcluster11 Blood pressure QTL cluster 11 6.922 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 13 31241331 93395974 Rat 2293702 Bss34 Bone structure and strength QTL 34 4.61 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 13 65103704 106807694 Rat 1354621 Rf47 Renal function QTL 47 3.7 kidney renin amount (VT:0010559) kidney renin level (CMO:0002166) 13 30395351 101056920 Rat 1354655 Bp241 Blood pressure QTL 241 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 56056920 101056920 Rat 4889606 Gluco63 Glucose level QTL 63 2.86 0.003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 13 80753256 106807694 Rat 8655945 Rf61 Renal function QTL 61 3.6 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 13 69060519 86800898 Rat 1331783 Bp221 Blood pressure QTL 221 3.72886 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 69060519 86800898 Rat 8655959 Pur32 Proteinuria QTL 32 8.4 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 13 74023918 97213863 Rat 1641901 Alcrsp6 Alcohol response QTL 6 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 13 52362171 97362171 Rat 1302791 Stl29 Serum triglyceride level QTL 29 3.3 0.0011 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 13 84730788 86800898 Rat 12879441 Bp396 Blood pressure QTL 396 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 45699983 90699983 Rat 2293687 Bss26 Bone structure and strength QTL 26 4.6 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 13 65103704 106807694 Rat 1300166 Kidm6 Kidney mass QTL 6 3.93 kidney mass (VT:0002707) single kidney wet weight to body weight ratio (CMO:0000622) 13 69060519 86800898 Rat 12879475 Bp400 Blood pressure QTL 400 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 61825626 106807694 Rat 1581570 Eae17 Experimental allergic encephalomyelitis QTL 17 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 8897350 101631289 Rat 1354666 Bp244 Blood pressure QTL 244 4.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 1 101056920 Rat 2293341 Glom15 Glomerulus QTL 15 9.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 13 74862117 101339893 Rat
RH128603
Rat Assembly Chr Position (strand) Source JBrowse RH 3.4 Map 13 566.2 UniSTS Cytogenetic Map 13 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
45
55
87
86
55
25
55
6
206
93
35
41
54
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000036040 ⟹ ENSRNOP00000029762
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 86,017,892 - 86,034,201 (-) Ensembl Rnor_6.0 Ensembl 13 92,073,668 - 92,089,980 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000097344 ⟹ ENSRNOP00000076437
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 86,020,410 - 86,034,201 (-) Ensembl
RefSeq Acc Id:
NM_001012029 ⟹ NP_001012029
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 88,550,224 - 88,567,892 (-) NCBI mRatBN7.2 13 86,017,888 - 86,035,556 (-) NCBI Rnor_6.0 13 92,073,664 - 92,091,335 (-) NCBI Rnor_5.0 13 96,545,815 - 96,606,181 (-) NCBI RGSC_v3.4 13 89,752,997 - 89,770,167 (-) RGD Celera 13 85,620,545 - 85,638,000 (-) RGD
Sequence:
CCAGGGACTAAACCACCATCCAAAGAGTACACATGGATAGACCCATGGCTCCAGCGGCATATATAACAGAAGATGGCCTTGTTGGGCACCAATGGGAGGAGAAGCATTTGGTCCTGCCAAGGCTCGAC CCCCGAGTATAAAGGCGGTCAAACCAAACAAGCCACTGCTTGGGTCACTGAAGGTCTTGGGATCCGAACATCGCTGCAGAGATTTCAAGGGAGGCTCACCCAACAACTTGAAAGATGTCAAATGAATA TAAGAGAATCGTTCTGTTGAAAGGACTTGAACCTCTCAGTAGTCATCATTTTAGCTTATTTAAGTCATTGCTGGCCAGTGATTTAAAACTGGAGAGACACATGCAGGAGCAATACACCAAGGTCCAGA TTGCTGACATGATGGAAGATGAATTCCCAGATGATGCTGGATTGGGCAAATTCATCAAATTTTGTGAAGACTTACCAGCTCTTAGAAAACGTGCTGAAATTCTTAAAAGAGAGAGAATACAAGTAAGA GGAGAAACCCCACGGGAAATAAATAGGCGAGAACCAGGTCCGTCAAGACCTTCATCAACTGCAAGCCATATGATAGTGTCTGAAGGATGGGAGACTTCCACAGCTCAGGCAGAGACCTCCACAGCTCA GGGAGAGCCTTCTACAGCTCAGAAAAGAAAAAGTATGAGCGAAGGAAAGACTGAAGTGAAAAAGACCAAGGCATCAGAGAGACCAGATCAGCCTCCCTGTCCTGAAGAAGCCACAGCCAAGTGTCTGT CACCAATACCCCAGACTTCGTCTTTGGCTCCATGTAACTCTCCTTTGGCTAAGTGTTCAATGGAGAACCAAAATATACAGACCCAAAACCAGAACATTCCCAGAGGCGCTGTTCTCCAAACAGAACCC CTGACAGTGATGGTGCTCAAAGCAACAGACCCATTTGAATATGAATCAGCAGAACATGGAGTGAAGAACATGTTTCTTGCTACAGTGGTTACTGTAGACCGGTATTTCCATGTGAAAGTTTTCAACAG CAACTTGAAAGAGAAGTTCAAAAAAAATAATTTTATCATCATTTCCAATTACTTCAAGAGGACAGACATCCTAGAGATCAATGAAGCTTCCCTTGTGTCAGAGGCTGCTCCTGACAAAAAGATTGCAG TGCCCAACAAACGTATCAAAGAGGCAAAAAAATCTCCTAAAATCCGTGATATTAAAGAGGGTACTTCAAGGGATCTGTTTTATGGAGTGTTTACATTAATCAAGAAAAAAGTGTGCCCAAAGAACACA ATCTATGAACTAAAAGATGATACAGGAAATATAGAAGTGGTGGGGAGTGGAAAATGGTACAACATCAACTGTAACGAAGGAGATAACTTCCAACTCTTCTGCTTTCACCTGAAAACAATTGACAGGCA ACAAAAATTAGTGTGTGGAAAGCACAGTTTTATCAAGGTCACCAGAGCTCGGGAAAAAAAGGAAGCAGCCACTGCCCATCCAAGCACAAAAAAGGAAGAAGGAACTCACTACCCTAAAGACAAATTCA ATGCTTTTAAAGAAGAGAAATAAAACGATCATGTCTAAATAATAGCTTTAGTAGTACATTCAAGCATTTAATGGTTTTCATAACTGACTTCTGATTTTGTATTTCCATTTGCAACGTTTTTTATTCTT CTGTTTTTCTATGAAAATAGCACTTGATTTAATTTTTCTATTGTAAAAGTAATAAACATCTTTTTAAAGGGACATCAATAAAAAAAAAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
NP_001012029 ⟸ NM_001012029
- UniProtKB:
Q5U2R8 (UniProtKB/TrEMBL), A0A8I5Y087 (UniProtKB/TrEMBL)
- Sequence:
MSNEYKRIVLLKGLEPLSSHHFSLFKSLLASDLKLERHMQEQYTKVQIADMMEDEFPDDAGLGKFIKFCEDLPALRKRAEILKRERIQVRGETPREINRREPGPSRPSSTASHMIVSEGWETSTAQAE TSTAQGEPSTAQKRKSMSEGKTEVKKTKASERPDQPPCPEEATAKCLSPIPQTSSLAPCNSPLAKCSMENQNIQTQNQNIPRGAVLQTEPLTVMVLKATDPFEYESAEHGVKNMFLATVVTVDRYFHV KVFNSNLKEKFKKNNFIIISNYFKRTDILEINEASLVSEAAPDKKIAVPNKRIKEAKKSPKIRDIKEGTSRDLFYGVFTLIKKKVCPKNTIYELKDDTGNIEVVGSGKWYNINCNEGDNFQLFCFHLK TIDRQQKLVCGKHSFIKVTRAREKKEAATAHPSTKKEEGTHYPKDKFNAFKEEK
hide sequence
Ensembl Acc Id:
ENSRNOP00000029762 ⟸ ENSRNOT00000036040
Ensembl Acc Id:
ENSRNOP00000076437 ⟸ ENSRNOT00000097344
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-07-09
Mnda
myeloid cell nuclear differentiation antigen
Ifi204
interferon activated gene 204
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2008-03-06
Ifi204
interferon activated gene 204
Mnda
myeloid cell nuclear differentiation antigen
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2005-12-06
Mnda
myeloid cell nuclear differentiation antigen
Mnda_predicted
myeloid cell nuclear differentiation antigen (predicted)
Symbol and Name updated
1559027
APPROVED
2005-01-12
Mnda_predicted
myeloid cell nuclear differentiation antigen (predicted)
Symbol and Name status set to approved
70820
APPROVED