Symbol:
Ntsr1
Name:
neurotensin receptor 1
RGD ID:
1306076
Description:
Enables identical protein binding activity. Involved in several processes, including amino acid import across plasma membrane; positive regulation of transport; and regulation of inositol phosphate biosynthetic process. Located in several cellular components, including dendrite; perikaryon; and symmetric synapse. Human ortholog(s) of this gene implicated in alcohol dependence; opiate dependence; and schizophrenia. Orthologous to human NTSR1 (neurotensin receptor 1); PARTICIPATES IN calcium/calcium-mediated signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; aflatoxin B1.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
high-affinity levocabastine-insensitive neurotensin receptor; LOC366274; neurotensin receptor; neurotensin receptor type 1; NT-R-1; NTR1; NTRH; Ntsr
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 187,983,778 - 188,033,934 (+) NCBI GRCr8 mRatBN7.2 3 167,606,215 - 167,656,371 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 167,606,215 - 167,656,377 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 171,986,455 - 172,036,627 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 180,945,543 - 180,995,717 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 177,607,136 - 177,657,300 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 175,982,313 - 176,046,345 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 175,885,894 - 176,046,345 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 179,681,394 - 179,747,034 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 169,567,488 - 169,633,121 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 169,473,987 - 169,536,964 (+) NCBI Celera 3 164,925,618 - 164,973,840 (-) NCBI Celera Cytogenetic Map 3 q43 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ntsr1 Rat (S)-nicotine increases expression ISO NTSR1 (Homo sapiens) 6480464 Nicotine results in increased expression of NTSR1 mRNA CTD PMID:23825647 Ntsr1 Rat 1,2-dimethylhydrazine decreases expression ISO Ntsr1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of NTSR1 mRNA CTD PMID:22206623 Ntsr1 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Ntsr1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Ntsr1 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Ntsr1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Ntsr1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of NTSR1 mRNA CTD PMID:33387578 Ntsr1 Rat 2,4,6-trinitrobenzenesulfonic acid multiple interactions ISO Ntsr1 (Mus musculus) 6480464 NTSR1 protein affects the reaction [Trinitrobenzenesulfonic Acid results in increased expression of VEGFA mRNA] CTD PMID:25307345 Ntsr1 Rat 2,4,6-trinitrobenzenesulfonic acid increases response to substance ISO Ntsr1 (Mus musculus) 6480464 NTSR1 protein results in increased susceptibility to Trinitrobenzenesulfonic Acid CTD PMID:25307345 Ntsr1 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Ntsr1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of NTSR1 mRNA CTD PMID:20188158 Ntsr1 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Ntsr1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of NTSR1 mRNA CTD PMID:18648102 Ntsr1 Rat 5-fluorouracil affects response to substance ISO NTSR1 (Homo sapiens) 6480464 NTSR1 protein affects the susceptibility to Fluorouracil CTD PMID:15352031 Ntsr1 Rat 5-fluorouracil decreases expression ISO NTSR1 (Homo sapiens) 6480464 Fluorouracil results in decreased expression of NTSR1 protein CTD PMID:15352031 Ntsr1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of NTSR1 mRNA CTD PMID:24780913 Ntsr1 Rat acrylamide increases expression ISO Ntsr1 (Mus musculus) 6480464 Acrylamide results in increased expression of NTSR1 mRNA CTD PMID:30807115 Ntsr1 Rat actinomycin D multiple interactions ISO NTSR1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of NTSR1 mRNA CTD PMID:38460933 Ntsr1 Rat aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of NTSR1 mRNA CTD PMID:23630614 Ntsr1 Rat aflatoxin B1 increases methylation ISO NTSR1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of NTSR1 exon CTD PMID:30157460 Ntsr1 Rat aflatoxin B1 decreases methylation ISO NTSR1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of NTSR1 intron CTD PMID:30157460 Ntsr1 Rat Aflatoxin B2 alpha affects methylation ISO NTSR1 (Homo sapiens) 6480464 aflatoxin B2 affects the methylation of NTSR1 intron CTD PMID:30157460 Ntsr1 Rat all-trans-retinoic acid increases expression ISO Ntsr1 (Mus musculus) 6480464 Tretinoin results in increased expression of NTSR1 mRNA CTD PMID:36189433 Ntsr1 Rat all-trans-retinoic acid multiple interactions ISO Ntsr1 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of NTSR1 mRNA CTD PMID:36189433 Ntsr1 Rat arsenous acid decreases expression ISO NTSR1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of NTSR1 mRNA CTD PMID:25258189 Ntsr1 Rat benzo[a]pyrene increases methylation ISO NTSR1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of NTSR1 5' UTR and Benzo(a)pyrene results in increased methylation of NTSR1 promoter CTD PMID:27901495 Ntsr1 Rat benzo[a]pyrene affects methylation ISO NTSR1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of NTSR1 intron and Benzo(a)pyrene affects the methylation of NTSR1 polyA tail CTD PMID:30157460 Ntsr1 Rat benzo[e]pyrene affects methylation ISO NTSR1 (Homo sapiens) 6480464 benzo(e)pyrene affects the methylation of NTSR1 intron CTD PMID:30157460 Ntsr1 Rat beta-lapachone increases expression ISO NTSR1 (Homo sapiens) 6480464 beta-lapachone results in increased expression of NTSR1 mRNA CTD PMID:38218311 Ntsr1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NTSR1 mRNA CTD PMID:25181051 Ntsr1 Rat bisphenol A decreases expression ISO Ntsr1 (Mus musculus) 6480464 bisphenol A results in decreased expression of NTSR1 mRNA CTD PMID:32156529 Ntsr1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of NTSR1 mRNA CTD PMID:30816183 Ntsr1 Rat bisphenol F decreases expression ISO Ntsr1 (Mus musculus) 6480464 bisphenol F results in decreased expression of NTSR1 mRNA CTD PMID:36706583 Ntsr1 Rat butanal increases expression ISO NTSR1 (Homo sapiens) 6480464 butyraldehyde results in increased expression of NTSR1 mRNA CTD PMID:26079696 Ntsr1 Rat cadmium atom multiple interactions ISO NTSR1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of NTSR1 mRNA CTD PMID:35301059 Ntsr1 Rat cadmium atom multiple interactions ISO Ntsr1 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of NTSR1 mRNA CTD PMID:37325564 Ntsr1 Rat cadmium dichloride multiple interactions ISO NTSR1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of NTSR1 mRNA CTD PMID:35301059 Ntsr1 Rat cadmium dichloride multiple interactions ISO Ntsr1 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of NTSR1 mRNA CTD PMID:37325564 Ntsr1 Rat CGP 52608 multiple interactions ISO NTSR1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to NTSR1 gene] CTD PMID:28238834 Ntsr1 Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of NTSR1 mRNA CTD PMID:26033743 Ntsr1 Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of NTSR1 mRNA CTD PMID:26033743 Ntsr1 Rat DDE decreases expression ISO NTSR1 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of NTSR1 mRNA CTD PMID:38568856 Ntsr1 Rat diarsenic trioxide decreases expression ISO NTSR1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of NTSR1 mRNA CTD PMID:25258189 Ntsr1 Rat diazinon increases methylation ISO NTSR1 (Homo sapiens) 6480464 Diazinon results in increased methylation of NTSR1 gene CTD PMID:22964155 Ntsr1 Rat ethanol affects expression ISO Ntsr1 (Mus musculus) 6480464 Ethanol affects the expression of NTSR1 mRNA CTD PMID:30319688 Ntsr1 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of NTSR1 mRNA CTD PMID:30307764 Ntsr1 Rat fonofos increases methylation ISO NTSR1 (Homo sapiens) 6480464 Fonofos results in increased methylation of NTSR1 promoter CTD PMID:22847954 Ntsr1 Rat glycidol increases expression EXP 6480464 glycidol results in increased expression of NTSR1 mRNA CTD PMID:24395379 Ntsr1 Rat GW 4064 decreases expression ISO Ntsr1 (Mus musculus) 6480464 GW 4064 results in decreased expression of NTSR1 mRNA CTD PMID:26655953 Ntsr1 Rat hexadecanoic acid increases expression ISO NTSR1 (Homo sapiens) 6480464 Palmitic Acid results in increased expression of NTSR1 mRNA CTD PMID:32347412 Ntsr1 Rat indole-3-methanol multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of NTSR1 mRNA CTD PMID:22129741 Ntsr1 Rat isoflavones affects expression ISO NTSR1 (Homo sapiens) 6480464 Isoflavones affects the expression of NTSR1 mRNA CTD PMID:16365062 Ntsr1 Rat Licochalcone B decreases expression ISO NTSR1 (Homo sapiens) 6480464 licochalcone B results in decreased expression of NTSR1 mRNA CTD PMID:33647349 Ntsr1 Rat lipopolysaccharide decreases expression ISO NTSR1 (Homo sapiens) 6480464 Lipopolysaccharides results in decreased expression of NTSR1 mRNA CTD PMID:35811015 Ntsr1 Rat lipopolysaccharide multiple interactions ISO NTSR1 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Ntsr1 Rat methapyrilene affects methylation ISO NTSR1 (Homo sapiens) 6480464 Methapyrilene affects the methylation of NTSR1 intron CTD PMID:30157460 Ntsr1 Rat methylmercury chloride decreases expression ISO Ntsr1 (Mus musculus) 6480464 methylmercuric chloride results in decreased expression of NTSR1 mRNA CTD PMID:21385734 Ntsr1 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Ntsr1 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of NTSR1 mRNA CTD PMID:36189433 Ntsr1 Rat morphine affects response to substance ISO Ntsr1 (Mus musculus) 6480464 NTSR1 protein affects the susceptibility to Morphine CTD PMID:20727387 Ntsr1 Rat N-methyl-4-phenylpyridinium increases expression ISO NTSR1 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of NTSR1 mRNA CTD PMID:24810058 Ntsr1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of NTSR1 mRNA CTD PMID:22129741 Ntsr1 Rat neurotensin affects binding ISO NTSR1 (Homo sapiens) 6480464 Neurotensin binds to NTSR1 protein CTD PMID:19874804 Ntsr1 Rat nicotine increases expression ISO NTSR1 (Homo sapiens) 6480464 Nicotine results in increased expression of NTSR1 mRNA CTD PMID:23825647 Ntsr1 Rat Nutlin-3 multiple interactions ISO NTSR1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of NTSR1 mRNA CTD PMID:38460933 Ntsr1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of NTSR1 mRNA CTD PMID:33387578 Ntsr1 Rat parathion increases methylation ISO NTSR1 (Homo sapiens) 6480464 Parathion results in increased methylation of NTSR1 promoter CTD PMID:22847954 Ntsr1 Rat PCB138 multiple interactions ISO Ntsr1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Ntsr1 Rat phencyclidine multiple interactions ISO Ntsr1 (Mus musculus) 6480464 NTSR1 gene affects the reaction [Phencyclidine results in decreased expression of DRD1 protein] CTD PMID:20659557 Ntsr1 Rat pinostrobin increases expression ISO NTSR1 (Homo sapiens) 6480464 pinostrobin results in increased expression of NTSR1 mRNA CTD PMID:37777166 Ntsr1 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO NTSR1 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Ntsr1 Rat silicon dioxide increases expression ISO NTSR1 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of NTSR1 mRNA CTD PMID:25895662 Ntsr1 Rat Soman increases expression EXP 6480464 Soman results in increased expression of NTSR1 mRNA CTD PMID:19281266 Ntsr1 Rat sotorasib multiple interactions ISO NTSR1 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of NTSR1 mRNA CTD PMID:36139627 Ntsr1 Rat terbufos increases methylation ISO NTSR1 (Homo sapiens) 6480464 terbufos results in increased methylation of NTSR1 promoter CTD PMID:22847954 Ntsr1 Rat testosterone decreases expression ISO Ntsr1 (Mus musculus) 6480464 Testosterone results in decreased expression of NTSR1 mRNA CTD PMID:19693291 Ntsr1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of NTSR1 mRNA CTD PMID:34492290 Ntsr1 Rat trametinib multiple interactions ISO NTSR1 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of NTSR1 mRNA CTD PMID:36139627 Ntsr1 Rat tris(2-butoxyethyl) phosphate affects expression ISO NTSR1 (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate affects the expression of NTSR1 mRNA CTD PMID:29024780 Ntsr1 Rat valproic acid increases methylation ISO NTSR1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of NTSR1 gene CTD PMID:29154799 Ntsr1 Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of NTSR1 mRNA CTD PMID:35594946
Imported Annotations - KEGG (archival)
(S)-nicotine (ISO) 1,2-dimethylhydrazine (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4,6-trinitrobenzenesulfonic acid (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-diaminodiphenylmethane (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (ISO) actinomycin D (ISO) aflatoxin B1 (EXP,ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) butanal (ISO) cadmium atom (ISO) cadmium dichloride (ISO) CGP 52608 (ISO) copper atom (EXP) copper(0) (EXP) DDE (ISO) diarsenic trioxide (ISO) diazinon (ISO) ethanol (ISO) fenvalerate (EXP) fonofos (ISO) glycidol (EXP) GW 4064 (ISO) hexadecanoic acid (ISO) indole-3-methanol (EXP) isoflavones (ISO) Licochalcone B (ISO) lipopolysaccharide (ISO) methapyrilene (ISO) methylmercury chloride (ISO) mono(2-ethylhexyl) phthalate (ISO) morphine (ISO) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP) neurotensin (ISO) nicotine (ISO) Nutlin-3 (ISO) paracetamol (EXP) parathion (ISO) PCB138 (ISO) phencyclidine (ISO) pinostrobin (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) silicon dioxide (ISO) Soman (EXP) sotorasib (ISO) terbufos (ISO) testosterone (ISO) thioacetamide (EXP) trametinib (ISO) tris(2-butoxyethyl) phosphate (ISO) valproic acid (EXP,ISO)
1.
Widespread expression in adult rat forebrain of mRNA encoding high-affinity neurotensin receptor.
Alexander MJ and Leeman SE, J Comp Neurol. 1998 Dec 28;402(4):475-500.
2.
Neurotensin receptor involvement in the rise of extracellular glutamate levels and apoptotic nerve cell death in primary cortical cultures after oxygen and glucose deprivation.
Antonelli T, etal., Cereb Cortex. 2008 Aug;18(8):1748-57. Epub 2007 Dec 5.
3.
Constitutive activation of the neurotensin receptor 1 by mutation of Phe(358) in Helix seven.
Barroso S, etal., Br J Pharmacol. 2002 Feb;135(4):997-1002.
4.
Cellular distribution of neurotensin receptors in rat brain: immunohistochemical study using an antipeptide antibody against the cloned high affinity receptor.
Boudin H, etal., J Comp Neurol. 1996 Sep 9;373(1):76-89.
5.
Correlative ultrastructural distribution of neurotensin receptor proteins and binding sites in the rat substantia nigra.
Boudin H, etal., J Neurosci. 1998 Oct 15;18(20):8473-84.
6.
Neurotensin activation of the NTR1 on spinally-projecting serotonergic neurons in the rostral ventromedial medulla is antinociceptive.
Buhler AV, etal., Pain. 2005 Mar;114(1-2):285-94. Epub 2005 Jan 26.
7.
Neurotensin depolarizes globus pallidus neurons in rats via neurotensin type-1 receptor.
Chen L, etal., Neuroscience. 2004;125(4):853-9.
8.
Effects of neurotensin on discharge rates of rat suprachiasmatic nucleus neurons in vitro.
Coogan AN, etal., Neuroscience. 2001;103(3):663-72.
9.
Developmental expression of the neurotensin gene in the rat liver.
Evers BM, etal., Ann Surg. 1993 Aug;218(2):183-8.
10.
Distribution of the neurotensin receptor NTS1 in the rat CNS studied using an amino-terminal directed antibody.
Fassio A, etal., Neuropharmacology. 2000 Jun 8;39(8):1430-42.
11.
Neurotensin receptor antagonist administered during cocaine withdrawal decreases locomotor sensitization and conditioned place preference.
Felszeghy K, etal., Neuropsychopharmacology. 2007 Dec;32(12):2601-10. doi: 10.1038/sj.npp.1301382. Epub 2007 Mar 14.
12.
Striatal NTS1 , dopamine D2 and NMDA receptor regulation of pallidal GABA and glutamate release--a dual-probe microdialysis study in the intranigral 6-hydroxydopamine unilaterally lesioned rat.
Ferraro L, etal., Eur J Neurosci. 2012 Jan;35(2):207-20. doi: 10.1111/j.1460-9568.2011.07949.x. Epub 2011 Dec 30.
13.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
14.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
15.
Intrathecal administration of NTS1 agonists reverses nociceptive behaviors in a rat model of neuropathic pain.
Guillemette A, etal., Eur J Pain. 2012 Apr;16(4):473-84. doi: 10.1016/j.ejpain.2011.07.008.
16.
Direct analysis of a GPCR-agonist interaction by surface plasmon resonance.
Harding PJ, etal., Eur Biophys J. 2006 Oct;35(8):709-12. Epub 2006 May 18.
17.
Modulation of the interaction between neurotensin receptor NTS1 and Gq protein by lipid.
Inagaki S, etal., J Mol Biol. 2012 Mar 16;417(1-2):95-111. doi: 10.1016/j.jmb.2012.01.023. Epub 2012 Jan 27.
18.
Dissection of chromosome 18 blood pressure and salt-sensitivity quantitative trait loci in the spontaneously hypertensive rat.
Johnson MD, etal., Hypertension. 2009 Sep;54(3):639-45. Epub 2009 Jul 20.
19.
Characterization of neurotensin receptors.
Kitabgi P and Pelaprat D, Curr Protoc Pharmacol. 2004 May;Chapter 1:Unit 1.29. doi: 10.1002/0471141755.ph0129s24.
20.
The role of neurotensin in passive avoidance learning in the rat central nucleus of amygdala.
Laszlo K, etal., Behav Brain Res. 2012 Jan 15;226(2):597-600. doi: 10.1016/j.bbr.2011.08.041. Epub 2011 Sep 21.
21.
An Association Study of Neurotensin Receptor Gene's Polymorphism with Schizophrenia
Lee YS, Kim HB, Han JH, Chai YG, Lee JS, Lee HS, Joo YH, Kim HS, Choi IG, Yang BH, J Korean Neuropsychiatr Assoc 1999 Nov;38(6):1494-1501.
22.
Synaptic Plasticity and Signal Transduction Gene Polymorphisms and Vulnerability to Drug Addictions in Populations of European or African Ancestry.
Levran O, etal., CNS Neurosci Ther. 2015 Nov;21(11):898-904. doi: 10.1111/cns.12450. Epub 2015 Sep 19.
23.
Association between neurotensin receptor 1 gene polymorphisms and alcohol dependence in a male Han Chinese population.
Ma H, etal., J Mol Neurosci. 2013 Oct;51(2):408-15. doi: 10.1007/s12031-013-0041-5. Epub 2013 Jun 8.
24.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
25.
Neurotensin inhibition of GABAergic transmission via mGluR-induced endocannabinoid signalling in rat periaqueductal grey.
Mitchell VA, etal., J Physiol. 2009 Jun 1;587(Pt 11):2511-20. doi: 10.1113/jphysiol.2008.167429. Epub 2009 Apr 9.
26.
Distinct regions of C-terminus of the high affinity neurotensin receptor mediate the functional coupling with pertussis toxin sensitive and insensitive G-proteins.
Najimi M, etal., FEBS Lett. 2002 Feb 13;512(1-3):329-33.
27.
Cytoskeleton-related trafficking of the EAAC1 glutamate transporter after activation of the G(q/11)-coupled neurotensin receptor NTS1.
Najimi M, etal., FEBS Lett. 2002 Jul 17;523(1-3):224-8.
28.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
29.
Neurotensin modulates synaptic transmission in the nucleus of the solitary tract of the rat.
Ogawa WN, etal., Neuroscience. 2005;130(2):309-15.
30.
High-affinity neurotensin receptor is involved in phosphoinositide hydrolysis stimulation by carbachol in neonatal rat brain.
Pereyra-Alfonso S, etal., Brain Res Dev Brain Res. 2005 Feb 8;154(2):247-54. Epub 2005 Jan 11.
31.
NTS2 modulates the intracellular distribution and trafficking of NTS1 via heterodimerization.
Perron A, etal., Biochem Biophys Res Commun. 2007 Feb 16;353(3):582-90. Epub 2006 Dec 18.
32.
Neurotensin activates GABAergic interneurons in the prefrontal cortex.
Petrie KA, etal., J Neurosci. 2005 Feb 16;25(7):1629-36.
33.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
34.
Acute, but not repeated, administration of the neurotensin NTS1 receptor agonist PD149163 decreases conditioned footshock-induced ultrasonic vocalizations in rats.
Prus AJ, etal., Prog Neuropsychopharmacol Biol Psychiatry. 2014 Mar 3;49:78-84. doi: 10.1016/j.pnpbp.2013.11.011. Epub 2013 Nov 23.
35.
GOA pipeline
RGD automated data pipeline
36.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
37.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
38.
Spinal NTS1 receptors regulate nociceptive signaling in a rat formalin tonic pain model.
Roussy G, etal., J Neurochem. 2008 May;105(4):1100-14. doi: 10.1111/j.1471-4159.2007.05205.x. Epub 2007 Dec 25.
39.
Pharmacology and functional properties of NTS2 neurotensin receptors in cerebellar granule cells.
Sarret P, etal., J Biol Chem 2002 Sep 27;277(39):36233-43.
40.
Binge-like intake of HFD attenuates alcohol intake in rats.
Sirohi S, etal., Physiol Behav. 2017 Sep 1;178:187-195. doi: 10.1016/j.physbeh.2016.10.006. Epub 2016 Oct 17.
41.
Differential involvement of intracellular domains of the rat NTS1 neurotensin receptor in coupling to G proteins: a molecular basis for agonist-directed trafficking of receptor stimulus.
Skrzydelski D, etal., Mol Pharmacol. 2003 Aug;64(2):421-9. doi: 10.1124/mol.64.2.421.
42.
Maternal separation enhances conditioned fear and decreases the mRNA levels of the neurotensin receptor 1 gene with hypermethylation of this gene in the rat amygdala.
Toda H, etal., PLoS One. 2014 May 15;9(5):e97421. doi: 10.1371/journal.pone.0097421. eCollection 2014.
43.
Neurotensin regulates intracellular calcium in ventral tegmental area astrocytes: evidence for the involvement of multiple receptors.
Trudeau LE Neuroscience. 2000;97(2):293-302.
44.
Immunohistochemical evidence for the implication of PC1 in the processing of proneurotensin in rat brain.
Villeneuve P, etal., Neuroreport. 2000 Nov 9;11(16):3443-7.
45.
Heterogeneity of melanized neurons expressing neurotensin receptor messenger RNA in the substantia nigra and the nucleus paranigralis of control and Parkinson's disease brain.
Yamada M, etal., Neuroscience. 1995 Jan;64(2):405-17.
46.
Regulation of daily rhythm of body temperature by neurotensin receptor in rats.
Yamada M, etal., Res Commun Mol Pathol Pharmacol. 1995 Mar;87(3):323-32.
Ntsr1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 187,983,778 - 188,033,934 (+) NCBI GRCr8 mRatBN7.2 3 167,606,215 - 167,656,371 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 167,606,215 - 167,656,377 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 171,986,455 - 172,036,627 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 180,945,543 - 180,995,717 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 177,607,136 - 177,657,300 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 175,982,313 - 176,046,345 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 175,885,894 - 176,046,345 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 179,681,394 - 179,747,034 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 169,567,488 - 169,633,121 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 169,473,987 - 169,536,964 (+) NCBI Celera 3 164,925,618 - 164,973,840 (-) NCBI Celera Cytogenetic Map 3 q43 NCBI
NTSR1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 62,708,836 - 62,762,771 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 62,708,836 - 62,762,771 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 61,340,188 - 61,394,123 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 60,810,634 - 60,864,568 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 60,810,633 - 60,864,567 NCBI Celera 20 58,015,902 - 58,069,780 (+) NCBI Celera Cytogenetic Map 20 q13.33 NCBI HuRef 20 58,057,195 - 58,112,133 (+) NCBI HuRef CHM1_1 20 61,240,216 - 61,294,517 (+) NCBI CHM1_1 T2T-CHM13v2.0 20 64,507,559 - 64,561,762 (+) NCBI T2T-CHM13v2.0
Ntsr1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 180,141,769 - 180,186,772 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 180,141,769 - 180,186,773 (+) Ensembl GRCm39 Ensembl GRCm38 2 180,499,976 - 180,544,979 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 180,499,976 - 180,544,980 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 180,234,681 - 180,279,684 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 180,429,384 - 180,474,387 (+) NCBI MGSCv36 mm8 Celera 2 184,584,976 - 184,630,855 (+) NCBI Celera Cytogenetic Map 2 H4 NCBI cM Map 2 103.04 NCBI
Ntsr1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955528 1,348,555 - 1,394,868 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955528 1,348,616 - 1,394,798 (-) NCBI ChiLan1.0 ChiLan1.0
NTSR1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 68,500,208 - 68,551,762 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 68,493,332 - 68,544,871 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 59,100,110 - 59,151,563 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 60,392,736 - 60,446,056 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 60,392,736 - 60,446,056 (+) Ensembl panpan1.1 panPan2
NTSR1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 46,576,690 - 46,615,192 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 46,576,501 - 46,615,206 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 45,761,069 - 45,799,295 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 47,445,631 - 47,483,515 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 47,445,292 - 47,483,519 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 46,546,845 - 46,585,056 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 46,670,214 - 46,708,469 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 47,425,128 - 47,463,367 (+) NCBI UU_Cfam_GSD_1.0
Ntsr1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 194,786,843 - 194,821,269 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936514 10,241,020 - 10,272,816 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936514 10,240,990 - 10,272,859 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NTSR1
NTSR1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 1,466,965 - 1,521,681 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 1,469,378 - 1,521,323 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666050 49,354,595 - 49,410,303 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ntsr1
.
Predicted Target Of
Count of predictions: 571 Count of miRNA genes: 235 Interacting mature miRNAs: 296 Transcripts: ENSRNOT00000039780 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
9589106 Insul23 Insulin level QTL 23 13.86 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 3 131635904 169034231 Rat 2312673 Scl63 Serum cholesterol level QTL 63 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 98535255 168026850 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 1578653 Vnigr3 Vascular neointimal growth QTL 3 3.1 artery morphology trait (VT:0002191) artery neointimal hyperplastic lesion area (CMO:0001414) 3 130656562 169034231 Rat 2303620 Vencon4 Ventilatory control QTL 4 3.9 respiration trait (VT:0001943) tidal volume (CMO:0000222) 3 127162703 168026850 Rat 1298068 Bp167 Blood pressure QTL 167 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 141074471 169034231 Rat 2298477 Eau4 Experimental allergic uveoretinitis QTL 4 0.0011 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 3 137398739 169034231 Rat 2312659 Slep7 Serum leptin concentration QTL 7 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 3 98535255 168026850 Rat 1578666 Vnigr1 Vascular neointimal growth QTL 1 4.6 artery morphology trait (VT:0002191) artery lumen area (CMO:0001409) 3 149040888 168026850 Rat 1300161 Rf10 Renal function QTL 10 3.57 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 3 161192952 169034231 Rat 8552791 Vie2 Viral induced encephalitis QTL 2 4.1 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 3 145956084 169034231 Rat 1578656 Vnigr2 Vascular neointimal growth QTL 2 4.2 artery morphology trait (VT:0002191) lesioned artery residual lumen area (CMO:0001417) 3 130656562 169034231 Rat 2317883 Alcrsp26 Alcohol response QTL 26 1.8 0.63 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 3 145526770 169034231 Rat 8552952 Pigfal13 Plasma insulin-like growth factor 1 level QTL 13 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 3 138799500 169034231 Rat 631541 Bp81 Blood pressure QTL 81 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 124122556 169034231 Rat 2312670 Bw94 Body weight QTL 94 0.01 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 3 98535255 168026850 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
10
43
110
64
61
37
11
37
6
148
74
93
21
59
24
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000039780 ⟹ ENSRNOP00000035997
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 167,606,215 - 167,656,377 (+) Ensembl Rnor_6.0 Ensembl 3 175,885,894 - 176,046,345 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000082073 ⟹ ENSRNOP00000072865
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 3 175,982,777 - 176,044,152 (+) Ensembl
RefSeq Acc Id:
NM_001108967 ⟹ NP_001102437
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 187,983,778 - 188,033,934 (+) NCBI mRatBN7.2 3 167,606,215 - 167,656,371 (+) NCBI Rnor_6.0 3 175,982,313 - 176,046,345 (+) NCBI Rnor_5.0 3 179,681,394 - 179,747,034 (+) NCBI RGSC_v3.4 3 169,567,488 - 169,633,121 (+) RGD Celera 3 164,925,618 - 164,973,840 (-) RGD
Sequence:
CAAGCAGAAGAGGGAGAACGAGGGTGAGCACACTGGGTAGCCGTGTGTGCGCTCCGCTCTGCGCCACAGGCTCCCCCAACGAAGCCACAAGCCAGCAGGGTCGCGGTCCTGAGGACATTACTACCACC
hide sequence
RefSeq Acc Id:
NP_001102437 ⟸ NM_001108967
- UniProtKB:
P20789 (UniProtKB/Swiss-Prot), A6KM97 (UniProtKB/TrEMBL)
- Sequence:
MHLNSSVPQGTPGEPDAQPFSGPQSEMEATFLALSLSNGSGNTSESDTAGPNSDLDVNTDIYSKVLVTAIYLALFVVGTVGNSVTAFTLARKKSLQSLQSTVHYHLGSLALSDLLILLLAMPVELYNF
hide sequence
Ensembl Acc Id:
ENSRNOP00000072865 ⟸ ENSRNOT00000082073
Ensembl Acc Id:
ENSRNOP00000035997 ⟸ ENSRNOT00000039780
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Ntsr1
neurotensin receptor 1
Ntsr1_predicted
neurotensin receptor 1 (predicted)
'predicted' is removed
2292626 APPROVED
2007-04-24
Ntsr1_predicted
neurotensin receptor 1 (predicted)
Ntsr1
neurotensin receptor 1
Data merged from RGD:619865
737654 APPROVED
2006-03-21
Ntsr1_predicted
neurotensin receptor 1 (predicted)
Ntsr_predicted
neurotensin receptor (predicted)
Symbol and Name updated to reflect Human and Mouse nomenclature
1299863 APPROVED
2005-01-20
Ntsr1
neurotensin receptor 1
Ntsr
neurotensin receptor
Symbol and Name updated
1299863 APPROVED
2005-01-12
Ntsr_predicted
neurotensin receptor (predicted)
Symbol and Name status set to approved
70820 APPROVED
2002-08-07
Ntsr
neurotensin receptor
Symbol and Name status set to provisional
70820 PROVISIONAL
