Advanced Search (OLGA)

Gene: Bloc1s4 (biogenesis of lysosomal organelles complex 1 subunit 4) Rattus norvegicus

Analyze

Symbol:

Bloc1s4

Name:

biogenesis of lysosomal organelles complex 1 subunit 4

RGD ID:

1306037

Description:

Predicted to be involved in anterograde synaptic vesicle transport. Predicted to act upstream of or within melanosome organization; neuromuscular process controlling balance; and platelet aggregation. Predicted to be located in cytoplasm. Predicted to be part of BLOC-1 complex. Orthologous to human BLOC1S4 (biogenesis of lysosomal organelles complex 1 subunit 4); INTERACTS WITH 2,4-dinitrotoluene; bisphenol A; Cuprizon.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

biogenesis of lysosomal organelles complex-1, subunit 4, cappuccino; biogenesis of lysosome-related organelles complex 1 subunit 4; cappuccino; cappuccino homolog (mouse); Cno; LOC364183; RGD1306037; similar to RIKEN cDNA 2610101N07

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	78,267,735 - 78,269,035 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	14	78,267,508 - 78,269,564 (+)	Ensembl				GRCr8
mRatBN7.2	14	74,043,025 - 74,044,325 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	74,043,015 - 74,044,531 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	14	78,485,295 - 78,486,595 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	79,726,145 - 79,727,445 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	76,171,119 - 76,172,419 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	79,013,808 - 79,015,108 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	79,013,807 - 79,015,112 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	14	87,207,216 - 87,208,516 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	14	79,624,027 - 79,625,327 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	14	72,981,512 - 72,982,812 (+)	NCBI		Celera
RGSC_v3.1	14	79,626,441 - 79,627,718 (+)	NCBI
Cytogenetic Map	14	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Hermansky-Pudlak syndrome (ISS)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

chlorpyrifos (ISO)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

Dibutyl phosphate (ISO)

diethylstilbestrol (ISO)

ethanol (ISO)

flutamide (EXP)

folic acid (ISO)

methotrexate (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

N,N-diethyl-m-toluamide (EXP)

nitrates (ISO)

paracetamol (ISO)

permethrin (EXP)

rac-lactic acid (ISO)

sodium arsenite (ISO)

tetrachloromethane (EXP,ISO)

thiram (ISO)

titanium dioxide (ISO)

tungsten (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

anterograde axonal transport (IEA,ISO)

anterograde synaptic vesicle transport (IEA,ISO)

melanosome organization (ISO)

neuromuscular process controlling balance (ISO)

platelet aggregation (ISO)

Cellular Component

axon cytoplasm (IEA)

BLOC-1 complex (IBA,IEA,ISO)

cytoplasm (IEA,ISO)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:11110696	PMID:12477932	PMID:12576321	PMID:21998198	PMID:22203680

Genomics

Comparative Map Data

Bloc1s4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	78,267,735 - 78,269,035 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	14	78,267,508 - 78,269,564 (+)	Ensembl				GRCr8
mRatBN7.2	14	74,043,025 - 74,044,325 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	74,043,015 - 74,044,531 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	14	78,485,295 - 78,486,595 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	79,726,145 - 79,727,445 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	76,171,119 - 76,172,419 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	79,013,808 - 79,015,108 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	79,013,807 - 79,015,112 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	14	87,207,216 - 87,208,516 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	14	79,624,027 - 79,625,327 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	14	72,981,512 - 72,982,812 (+)	NCBI		Celera
RGSC_v3.1	14	79,626,441 - 79,627,718 (+)	NCBI
Cytogenetic Map	14	q21	NCBI

BLOC1S4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	6,716,174 - 6,717,664 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	6,716,174 - 6,717,664 (+)	Ensembl			hg38	GRCh38
GRCh37	4	6,717,901 - 6,719,391 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	6,768,743 - 6,770,288 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	4	6,619,850 - 6,621,391 (+)	NCBI		Celera
Cytogenetic Map	4	p16.1	NCBI
HuRef	4	6,649,513 - 6,651,054 (+)	NCBI		HuRef
CHM1_1	4	6,716,222 - 6,717,763 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	4	6,691,231 - 6,692,721 (+)	NCBI		T2T-CHM13v2.0

Bloc1s4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	36,904,718 - 36,906,023 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	36,904,722 - 36,905,994 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	36,747,374 - 36,748,679 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	36,747,378 - 36,748,650 (-)	Ensembl			mm10	GRCm38
MGSCv37	5	37,138,613 - 37,139,918 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	37,035,419 - 37,036,908 (-)	NCBI		MGSCv36	mm8
Celera	5	34,198,608 - 34,199,913 (-)	NCBI		Celera
Cytogenetic Map	5	B3	NCBI
cM Map	5	19.24	NCBI

Bloc1s4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955514	3,698,644 - 3,699,227 (-)	NCBI	ChiLan1.0	ChiLan1.0

BLOC1S4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	6,983,342 - 6,987,293 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	6,911,399 - 6,915,349 (+)	NCBI		NHGRI_mPanPan1
PanPan1.1	4	6,787,798 - 6,789,100 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	6,787,943 - 6,788,596 (+)	Ensembl			panPan2	panpan1.1

BLOC1S4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	58,822,405 - 58,823,770 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	58,822,482 - 58,823,138 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	61,470,267 - 61,471,603 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	59,289,370 - 59,290,706 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	3	59,289,396 - 59,290,360 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	3	58,792,106 - 58,793,442 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	58,994,357 - 58,995,693 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	59,342,946 - 59,344,282 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Bloc1s4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405285	64,916,598 - 64,917,820 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936477	18,618,499 - 18,619,140 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936477	18,618,330 - 18,619,512 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

BLOC1S4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	4,092,050 - 4,095,772 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	8	4,093,619 - 4,095,790 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	3,145,135 - 3,146,221 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

BLOC1S4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	27	42,836,231 - 42,837,514 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	27	42,836,366 - 42,837,016 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666047	89,643,637 - 89,645,080 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Bloc1s4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624755	23,031,649 - 23,033,282 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Bloc1s4
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	11	68,386,409 - 68,387,427 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Bloc1s4
2 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	301
Count of miRNA genes:	193
Interacting mature miRNAs:	222
Transcripts:	ENSRNOT00000008127
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313089	Bss81	Bone structure and strength QTL 81	3.4	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	14	38023710	83023710	Rat
9590294	Uminl4	Urine mineral level QTL 4	5.66	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	14	59848686	104848686	Rat
1582236	Gluco22	Glucose level QTL 22	3.3	0.0164	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	77640071	96755654	Rat
2300197	Scl59	Serum cholesterol level QTL 59			blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	14	77914838	104348525	Rat
70214	Niddm28	Non-insulin dependent diabetes mellitus QTL 28	4.06		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	39009444	84009444	Rat
70153	Bp59	Blood pressure QTL 59	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	14	72970210	87582095	Rat
70187	Pancm5	Pancreatic morphology QTL 5	16.7		pancreas mass (VT:0010144)	pancreas weight to body weight ratio (CMO:0000630)	14	30674469	85041098	Rat
631523	Pia13	Pristane induced arthritis QTL 13	3.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	14	33424686	102238540	Rat
1582259	Gluco23	Glucose level QTL 23	3.1	0.0008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	74255551	109089856	Rat
1582197	Gluco27	Glucose level QTL 27	3.4	0.0006	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	77640071	96755654	Rat
2313100	Bss82	Bone structure and strength QTL 82	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	14	38023710	83023710	Rat
634328	Hc5	Hypercalciuria QTL 5	2.3		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	14	62398852	107398852	Rat
1582250	Gluco26	Glucose level QTL 26	3.3	0.0009	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	77640071	100078267	Rat
2317879	Alcrsp27	Alcohol response QTL 27	3.3	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	14	60854936	105854936	Rat
1641900	Alcrsp11	Alcohol response QTL 11			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	14	74255551	109089856	Rat
631839	Niddm37	Non-insulin dependent diabetes mellitus QTL 37	3.37		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11334716	100078267	Rat
1582255	Gluco29	Glucose level QTL 29	3.1	0.0025	blood glucose amount (VT:0000188)	absolute change in blood glucose level area under curve (CMO:0002034)	14	77640071	96755654	Rat
9589034	Epfw11	Epididymal fat weight QTL 11	6	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	14	59848686	104848686	Rat
1582209	Gluco20	Glucose level QTL 20	3.8	0.0005	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	77640071	96755654	Rat
2313048	Bss84	Bone structure and strength QTL 84	3.1	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	14	38023710	83023710	Rat
1300136	Rf22	Renal function QTL 22	3.9		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	14	42616258	99224555	Rat
1549834	Scl45	Serum cholesterol level QTL 45	5.8		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	14	65920283	99224555	Rat
738037	Hcas6	Hepatocarcinoma susceptibility QTL 6	2.93		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	14	39411170	87582095	Rat
2313084	Bss83	Bone structure and strength QTL 83	2.9	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	14	38023710	83023710	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	163	91	90	59	92	59	6	356	192	11	142	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001100766	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC111885	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC091265	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473963	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213984	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231317	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000091068 ⟹ ENSRNOP00000072054

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	14	78,267,508 - 78,269,564 (+)	Ensembl
mRatBN7.2 Ensembl	14	74,043,015 - 74,044,531 (+)	Ensembl
Rnor_6.0 Ensembl	14	79,013,807 - 79,015,112 (+)	Ensembl

RefSeq Acc Id:

NM_001100766 ⟹ NP_001094236

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	78,267,735 - 78,269,035 (+)	NCBI
mRatBN7.2	14	74,043,025 - 74,044,325 (+)	NCBI
Rnor_6.0	14	79,013,808 - 79,015,108 (+)	NCBI
Rnor_5.0	14	87,207,216 - 87,208,516 (+)	NCBI
RGSC_v3.4	14	79,624,027 - 79,625,327 (+)	RGD
Celera	14	72,981,512 - 72,982,812 (+)	RGD

Sequence:

show sequence

GCACCGGAAGCGGCCAGGCGGGCCATGGAGGAAGGACCCGCGATCGGAACCCTGTCTCGAGAGG
TCTCGACTGAGGAGGCCGAGCCGTTGGTCGCCGCGTGGAGCGGGGACAGCGGCCACGTATCGCA
GAGCCACAGCAGCGCGTCCGGACCTTGGGAAGATGACGGCACCGAGGACGCGCCAGGCCGCGAC
CTGCCGCTGCTGCGCCGCGCCGCCTTGGGCTACGCCTCCAGCTTGCTGCCTGCCACCGGGCCGC
GGCCGGAGGTGGAGGCGCTGGACGCCAGCCTGGAGGACCTGCTCGCCAAGGTGGACGAGTTCGT
GGGCATGCTGGACATGATTCGCGGAGACTCGTCTCATGTGGTGAGCGAGGGTGTGCCTCGGATC
CACGCTAAAGCCGCCGAGATGAGGCGCATCTACGGCAGAATCGACAAACTAGAGGCCTTCGTGA
GGATGATCGGTAGTAGCGTGGCCAGAATGGAGGAGCAAGTCACCAAGGCCGAAGCCGAACTGGG
GACCTTCCCCCGAGCCTTTCGGAGGCTGCTGCATACCATCAGCGTTCCCGCTCTCTTTAAGTCG
GCGCCCACCGCGCCCCAGCGCGCAGTGTACGAGCCGCCAGTCCTGTTTCGGACAGAGGATCACT
TCCCTGGCAGCGGTGACAGACCGCAACTCTGAGCGTGAAGCTCTACCACAGGAGGACTCCAGTG
AGACTCTTGTCCAGACTGTTAATTGGCATACATGATACCGCCTTGTGAAATGTTAAAGTTTATT
TTCTGCAAGCGACTTGACATCGATGTCAAGAGTGTAGATCCTTATGTCTTCCAGTGCTGATTCA
AAAGCTCTTTGGTCGGGGCCTGGGGAAGCCAATTGAATTAATTTATCTGTGCAATATGGCAGAG
CTGTTATTTTATGGCCTTTATTACAGTGAACAGTGTTACCTTGTTAAGATTTATATATTTATAT
GATCAAAAGTGACCAAGAAATTAAAGCTGTATTCTTAAATCGTAACAGTGGTTCAGTTTTCTGT
AGCATTCTGGGAAAGATGGCAGATTCAATATTATGTTCAGTTTTCCATAGCGTGGAAACGCAAT
CGCTTAGCACCGGAAGCGGCCAGGCGGGCCATGGAGGAAGGACCCGCGTTGTAAACCAACGGAA
ACAAGATAGCAAACTGGGCGTTTTGTGCAGAGAGTTCTGAAGTTGTATTTGACAGTATGACTCA
GACTTAGTTTATCAAAGCAAGCATATTAATGTATGGTTGTCAGTGGTCTATAACACATTCATTA
AAATGTTAAATTTCTTTGGCA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001094236	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH91265	(Get FASTA)	NCBI Sequence Viewer
	EDM00042	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000072054
	ENSRNOP00000072054.1

RefSeq Acc Id:

NP_001094236 ⟸ NM_001100766

- UniProtKB:

G3V6R9 (UniProtKB/TrEMBL), A6IJX8 (UniProtKB/TrEMBL), Q5BJZ8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEEGPAIGTLSREVSTEEAEPLVAAWSGDSGHVSQSHSSASGPWEDDGTEDAPGRDLPLLRRAA
LGYASSLLPATGPRPEVEALDASLEDLLAKVDEFVGMLDMIRGDSSHVVSEGVPRIHAKAAEMR
RIYGRIDKLEAFVRMIGSSVARMEEQVTKAEAELGTFPRAFRRLLHTISVPALFKSAPTAPQRA
VYEPPVLFRTEDHFPGSGDRPQL

hide sequence

Ensembl Acc Id:

ENSRNOP00000072054 ⟸ ENSRNOT00000091068

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V6R9-F1-model_v2	AlphaFold	G3V6R9	1-215	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699378

Promoter ID:

EPDNEW_R9903

Type:

multiple initiation site

Name:

Bloc1s4_1

Description:

biogenesis of lysosomal organelles complex 1 subunit 4

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	14	79,013,823 - 79,013,883	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306037	AgrOrtholog
BioCyc Gene	G2FUF-15343	BioCyc
Ensembl Genes	ENSRNOG00000054224	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000091068	ENTREZGENE
	ENSRNOT00000091068.3	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7379240	IMAGE-MGC_LOAD
InterPro	Cappuccino	UniProtKB/TrEMBL
KEGG Report	rno:364183	UniProtKB/TrEMBL
MGC_CLONE	MGC:109106	IMAGE-MGC_LOAD
NCBI Gene	364183	ENTREZGENE
PANTHER	BIOGENESIS OF LYSOSOME-RELATED ORGANELLES COMPLEX 1 SUBUNIT 4	UniProtKB/TrEMBL
	PTHR16230	UniProtKB/TrEMBL
PhenoGen	Bloc1s4	PhenoGen
RatGTEx	ENSRNOG00000054224	RatGTEx
UniProt	A6IJX8	ENTREZGENE, UniProtKB/TrEMBL
	G3V6R9	ENTREZGENE, UniProtKB/TrEMBL
	Q5BJZ8	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-01-20	Bloc1s4	biogenesis of lysosomal organelles complex 1 subunit 4	Bloc1s4	biogenesis of lysosomal organelles complex-1, subunit 4, cappuccino	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-08-08	Bloc1s4	biogenesis of lysosomal organelles complex-1, subunit 4, cappuccino	Cno	cappuccino homolog (mouse)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-09	Cno	cappuccino homolog (mouse)	Cno	cappuccino	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-03	Cno	cappuccino	Cno	cappuccino homolog (mouse)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Cno	cappuccino homolog (mouse)	RGD1306037	similar to RIKEN cDNA 2610101N07	Symbol and Name updated	1299863	APPROVED
2005-12-06	RGD1306037	similar to RIKEN cDNA 2610101N07	RGD1306037_predicted	similar to RIKEN cDNA 2610101N07 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1306037_predicted	similar to RIKEN cDNA 2610101N07 (predicted)	LOC364183_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC364183_predicted	similar to RIKEN cDNA 2610101N07 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - MGI