Advanced Search (OLGA)

Gene: Nodal (nodal growth differentiation factor) Rattus norvegicus

Analyze

Symbol:

Nodal

Name:

nodal growth differentiation factor

RGD ID:

1305994

Description:

Predicted to enable cytokine activity and type I activin receptor binding activity. Involved in female pregnancy. Predicted to be located in extracellular region. Predicted to be active in extracellular space. Human ortholog(s) of this gene implicated in visceral heterotaxy 5. Orthologous to human NODAL (nodal growth differentiation factor); PARTICIPATES IN transforming growth factor-beta superfamily mediated signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; paracetamol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC294503; nodal homolog; nodal homolog (mouse)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NODAL (nodal growth differentiation factor)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Nodal (nodal growth differentiation factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Nodal (nodal growth differentiation factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NODAL (nodal growth differentiation factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NODAL (nodal growth differentiation factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Nodal (nodal growth differentiation factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NODAL (nodal growth differentiation factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NODAL (nodal growth differentiation factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Nodal (nodal growth differentiation factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Nodal (nodal growth differentiation factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	DNAJC1 (DnaJ heat shock protein family (Hsp40) member C1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	NODAL (nodal growth differentiation factor)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Nodal (nodal growth differentiation factor)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	spaw (southpaw)	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	spaw (southpaw)	Alliance	DIOPT (InParanoid\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ndr2 (nodal-related 2)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	ndr1 (nodal-related 1)	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	ndr1 (nodal-related 1)	Alliance	DIOPT (InParanoid\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	mav	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	nodal	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	nodal	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	nodal3.1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	nodal2	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	nodal2	Alliance	DIOPT (OMA\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	nodal1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	nodal1	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	nodal6	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	nodal6	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	nodal5	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	nodal5	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	nodal3.2	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	nodal3.2	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	LOC116409495	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	nodal3.4	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	LOC101734231	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	LOC100490072	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	LOC101734231	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	29,911,258 - 29,919,659 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	20	29,911,258 - 29,919,659 (+)	Ensembl				GRCr8
mRatBN7.2	20	29,368,436 - 29,376,837 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	29,368,436 - 29,376,837 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	20	30,384,407 - 30,392,808 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	29,770,653 - 29,779,054 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	30,513,159 - 30,521,560 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	31,035,729 - 31,044,096 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	31,035,729 - 31,044,096 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	20	32,822,880 - 32,831,247 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	20	29,546,982 - 29,555,419 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	20	30,797,163 - 30,805,518 (+)	NCBI		Celera
RGSC_v3.1	20	29,560,988 - 29,568,536 (+)	NCBI
Cytogenetic Map	20	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

congenital heart disease (ISO)

Congenitally Corrected Transposition of the Great Arteries (ISO)

genetic disease (ISO)

holoprosencephaly (ISO)

neuroblastoma (ISO)

Pulmonary Atresia (ISO)

tetralogy of Fallot (ISO)

visceral heterotaxy (ISO)

visceral heterotaxy 5 (ISO)

Wolff-Parkinson-White syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4,4'-diaminodiphenylmethane (ISO)

5-aza-2'-deoxycytidine (ISO)

5-fluorouracil (ISO)

acetaldehyde (ISO)

acetic acid (ISO)

actinomycin D (ISO)

Activin A (ISO)

all-trans-retinoic acid (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bromochloroacetic acid (ISO)

Butylbenzyl phthalate (ISO)

carbon nanotube (ISO)

carboplatin (ISO)

CHIR 99021 (ISO)

chlorpyrifos (ISO)

choline (ISO)

cisplatin (ISO)

crocidolite asbestos (ISO)

Dibutyl phosphate (ISO)

ethanol (ISO)

fluoxetine (ISO)

flusilazole (ISO)

folic acid (ISO)

L-methionine (ISO)

methylmercury chloride (ISO)

mono(2-ethylhexyl) phthalate (ISO)

Nutlin-3 (ISO)

paracetamol (EXP,ISO)

phenylephrine (EXP)

potassium dichromate (ISO)

progesterone (EXP)

resveratrol (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

testosterone (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

anatomical structure formation involved in morphogenesis (ISO)

anterior/posterior axis specification (ISO)

anterior/posterior pattern specification (ISO)

apoptotic signaling pathway (IEA,ISO)

axial mesodermal cell fate specification (ISO)

brain development (ISO)

cell differentiation (IBA)

cell fate commitment (ISO)

cell migration (ISO)

cell migration involved in gastrulation (ISO)

determination of left/right asymmetry in lateral mesoderm (IEA,ISO)

determination of left/right symmetry (ISO)

digestive system development (ISO)

digestive tract morphogenesis (ISO)

embryonic cranial skeleton morphogenesis (ISO)

embryonic heart tube development (ISO)

embryonic pattern specification (ISO)

embryonic placenta development (ISO)

embryonic process involved in female pregnancy (ISO)

endoderm development (ISO)

endodermal cell differentiation (IEA,ISO)

epiblast cell-extraembryonic ectoderm cell signaling (ISO)

female pregnancy (IEP)

floor plate morphogenesis (ISO)

formation of anatomical boundary (ISO)

formation of primary germ layer (IEA)

gastrulation (ISO)

gastrulation with mouth forming second (ISO)

heart development (ISO)

heart looping (ISO)

in utero embryonic development (ISO)

inhibition of neuroepithelial cell differentiation (ISO)

left lung morphogenesis (ISO)

liver development (ISO)

lung development (ISO)

maternal placenta development (ISO)

maternal process involved in parturition (ISO)

mesendoderm development (IEA,ISO)

mesoderm formation (ISO)

negative regulation of androgen receptor signaling pathway (IEA,ISO)

negative regulation of cell development (ISO)

negative regulation of cell differentiation (ISO)

negative regulation of chorionic trophoblast cell proliferation (IEA,ISO)

negative regulation of reproductive process (IEA)

negative regulation of transcription by RNA polymerase II (ISO)

negative regulation of trophoblast cell migration (IEA,ISO)

nervous system development (ISO)

neural fold formation (ISO)

nodal signaling pathway (IBA,IEA,ISO)

placenta development (IEA,ISO)

polarity specification of proximal/distal axis (ISO)

positive regulation of angiogenesis (IEA,ISO)

positive regulation of cell population proliferation (ISO)

positive regulation of cell-cell adhesion (IEA,ISO)

positive regulation of epithelial cell proliferation (IEA,ISO)

positive regulation of ERK1 and ERK2 cascade (IEA,ISO)

positive regulation of SMAD protein signal transduction (IEA,ISO)

positive regulation of transcription by RNA polymerase II (IEA,ISO)

positive regulation of vascular endothelial growth factor production (ISO)

primitive streak formation (ISO)

regulation of gastrulation (ISO)

regulation of signal transduction (ISO)

stem cell population maintenance (ISO)

tissue morphogenesis (ISO)

transforming growth factor beta receptor signaling pathway (ISO)

trophectodermal cell differentiation (ISO)

trophectodermal cellular morphogenesis (ISO)

vasculature development (ISO)

Cellular Component

extracellular region (IEA,ISO)

extracellular space (IBA,IEA,ISO)

Molecular Function

cytokine activity (IBA,IEA,ISO)

growth factor activity (IEA)

protein binding (ISO)

receptor ligand activity (IEA,ISO)

type I activin receptor binding (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

transforming growth factor-beta superfamily mediated signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Embryo presence regulates NODAL/LEFTY2 system in the rat oviduct in vivo.	Argañaraz ME, etal., Mol Reprod Dev. 2019 Nov;86(11):1652-1662. doi: 10.1002/mrd.23254. Epub 2019 Aug 16.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Identification and functional characterization of NODAL rare variants in heterotaxy and isolated cardiovascular malformations.	Mohapatra B, etal., Hum Mol Genet. 2009 Mar 1;18(5):861-71. doi: 10.1093/hmg/ddn411. Epub 2008 Dec 8.
5.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	ACVR2A promoter polymorphism rs1424954 in the Activin-A signaling pathway in trophoblasts.	Thulluru HK, etal., Placenta. 2015 Apr;36(4):345-9. doi: 10.1016/j.placenta.2015.01.010. Epub 2015 Jan 26.
10.	Nodal increases the malignancy of childhood neuroblastoma cells via regulation of Zeb1.	Wu J, etal., Biofactors. 2019 May;45(3):355-363. doi: 10.1002/biof.1505. Epub 2019 Apr 15.

Additional References at PubMed

PMID:7924997	PMID:9420335	PMID:11311163	PMID:11418863	PMID:11456449	PMID:12052855	PMID:12231623	PMID:12642485	PMID:12654299	PMID:12842913	PMID:14511481	PMID:14607953
PMID:15004567	PMID:15150278	PMID:15302604	PMID:15466485	PMID:15485907	PMID:15505202	PMID:16496285	PMID:16678814	PMID:16709598	PMID:17507406	PMID:17568773	PMID:17936261
PMID:20040491	PMID:21116837	PMID:21356369	PMID:21445260	PMID:21656830	PMID:21741376	PMID:22378764	PMID:22550067	PMID:23034635	PMID:28182636	PMID:31298343	PMID:34737126

Genomics

Comparative Map Data

Nodal
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	29,911,258 - 29,919,659 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	20	29,911,258 - 29,919,659 (+)	Ensembl				GRCr8
mRatBN7.2	20	29,368,436 - 29,376,837 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	29,368,436 - 29,376,837 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	20	30,384,407 - 30,392,808 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	29,770,653 - 29,779,054 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	30,513,159 - 30,521,560 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	31,035,729 - 31,044,096 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	31,035,729 - 31,044,096 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	20	32,822,880 - 32,831,247 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	20	29,546,982 - 29,555,419 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	20	30,797,163 - 30,805,518 (+)	NCBI		Celera
RGSC_v3.1	20	29,560,988 - 29,568,536 (+)	NCBI
Cytogenetic Map	20	q11	NCBI

NODAL
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	70,431,936 - 70,447,951 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	70,431,936 - 70,447,951 (-)	Ensembl			hg38	GRCh38
GRCh37	10	72,191,692 - 72,207,707 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	71,862,077 - 71,871,429 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	10	71,862,076 - 71,871,429	NCBI
Celera	10	65,472,123 - 65,481,898 (-)	NCBI		Celera
Cytogenetic Map	10	q22.1	NCBI
HuRef	10	66,185,532 - 66,195,306 (-)	NCBI		HuRef
CHM1_1	10	72,473,912 - 72,483,685 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	10	71,301,367 - 71,317,383 (-)	NCBI		T2T-CHM13v2.0

Nodal
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	61,253,751 - 61,261,117 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	61,253,751 - 61,261,117 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	10	61,417,972 - 61,425,338 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	61,417,972 - 61,425,338 (+)	Ensembl			mm10	GRCm38
MGSCv37	10	60,880,720 - 60,888,085 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	10	60,813,657 - 60,819,993 (+)	NCBI		MGSCv36	mm8
Celera	10	62,519,279 - 62,526,659 (+)	NCBI		Celera
Cytogenetic Map	10	B4	NCBI
cM Map	10	32.21	NCBI

Nodal
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955437	20,828,448 - 20,835,628 (+)	Ensembl
ChiLan1.0	NW_004955437	20,828,448 - 20,835,486 (+)	NCBI	ChiLan1.0	ChiLan1.0

NODAL
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	82,580,547 - 82,596,805 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	82,585,868 - 82,602,126 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	66,906,866 - 66,916,938 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	69,433,959 - 69,443,972 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	69,433,959 - 69,443,972 (-)	Ensembl			panPan2	panpan1.1

NODAL
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	21,366,828 - 21,374,623 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	21,367,583 - 21,375,151 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	21,499,043 - 21,506,382 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	21,641,721 - 21,649,105 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	21,641,856 - 21,649,745 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	21,539,356 - 21,546,535 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	21,744,769 - 21,751,938 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	22,096,050 - 22,103,419 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Nodal
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	59,674,355 - 59,686,268 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936521	8,171,146 - 8,178,705 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936521	8,171,146 - 8,178,802 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NODAL
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	73,353,258 - 73,360,654 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	14	73,350,358 - 73,357,064 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

NODAL
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	60,852,567 - 60,863,225 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	60,853,763 - 60,862,839 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666048	21,593,182 - 21,609,737 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nodal
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624754	4,557,952 - 4,564,644 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624754	4,557,407 - 4,564,580 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Nodal
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	18	27,254,330 - 27,262,479 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Nodal
44 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	435
Count of miRNA genes:	230
Interacting mature miRNAs:	274
Transcripts:	ENSRNOT00000000672
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2303587	Bw93	Body weight QTL 93	13		body mass (VT:0001259)	body weight (CMO:0000012)	20	26689362	56021148	Rat
4889610	Pancm3	Pancreatic morphology QTL 3	3.75	0.001	pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	20	4189476	49189476	Rat
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1	33724594	Rat
2305926	Iddm37	Insulin dependent diabetes mellitus QTL 37	6		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	20	1533083	46533083	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600300	Rat
1558640	Prcs2	Prostate cancer susceptibility QTL 2	3.3		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	20	1	34066551	Rat
2303626	Vencon10	Ventilatory control QTL 10		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	20	20745585	56021148	Rat
1598869	Memor6	Memory QTL 6	3.1		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	20	26689362	56021148	Rat
1598870	Bp289	Blood pressure QTL 289	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	20	8216359	53216359	Rat
1598858	Cm61	Cardiac mass QTL 61	3.6		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	20	8216359	53216359	Rat
1331747	Hrtrt16	Heart rate QTL 16	3.163		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	20	26792353	56021148	Rat
1598816	Memor12	Memory QTL 12	2.4		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	20	12243242	49189476	Rat
2303578	Gluco50	Glucose level QTL 50	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	20	26689362	56021148	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578510	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600300	Rat
2300188	Bmd68	Bone mineral density QTL 68	6.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	20	26689362	56021148	Rat

Markers in Region

Nodal

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	29,375,222 - 29,376,136 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	31,042,482 - 31,043,395	NCBI	Rnor6.0
Rnor_5.0	20	32,829,633 - 32,830,546	UniSTS	Rnor5.0
RGSC_v3.4	20	29,553,805 - 29,554,718	UniSTS	RGSC3.4
Celera	20	30,803,904 - 30,804,817	UniSTS
Cytogenetic Map	20	q11	UniSTS

Nodal

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	29,375,150 - 29,376,079 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	31,042,410 - 31,043,338	NCBI	Rnor6.0
Rnor_5.0	20	32,829,561 - 32,830,489	UniSTS	Rnor5.0
Celera	20	30,803,832 - 30,804,760	UniSTS
Cytogenetic Map	20	q11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
6	3	13	38	42	40	18	29	18	6	120	59	27	35	55	22	3	3

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106394	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000000672 ⟹ ENSRNOP00000000672

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	20	29,911,258 - 29,919,659 (+)	Ensembl
mRatBN7.2 Ensembl	20	29,368,436 - 29,376,837 (+)	Ensembl
Rnor_6.0 Ensembl	20	31,035,729 - 31,044,096 (+)	Ensembl

RefSeq Acc Id:

NM_001106394 ⟹ NP_001099864

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	29,911,258 - 29,919,659 (+)	NCBI
mRatBN7.2	20	29,368,436 - 29,376,837 (+)	NCBI
Rnor_6.0	20	31,035,729 - 31,044,096 (+)	NCBI
Rnor_5.0	20	32,822,880 - 32,831,247 (+)	NCBI
RGSC_v3.4	20	29,546,982 - 29,555,419 (+)	RGD
Celera	20	30,797,163 - 30,805,518 (+)	RGD

Sequence:

show sequence

CTGTCTCAGCAGGAAGACTTGGGGTAGAGGGGCAAGGTGCGGAACAGCCTAGACTCAGCCTCTG
TATCCACGCCCCCCACACCCCCCCCCGCCCCGGTCCCAATTTATCAGAAGTCTTTCTCAGCACA
TCACACCTCCTCCCAGCAGGGACTCCCCTGCCCTGCCCCTCCAGGGGGTGTTATAGGTTCTTAA
GGTTTCTTCGGAGGGAGGAAGGGAGGGGGGGCGGGGCGGCGGCGGCTCAGATATAAGGGACCCG
GGCGTTGTTGGAGAGTCCAATTAGCCCACCATGAGTGTCCACTGCCTTCCCGTTCTTCTTCTCC
AAACCTGCTGGACCCTACTCCACCCGCGCGTCGCGACCGCGGCCGCTTTGCCTCTGTGGACACG
GGGGCAGCCCTCGTCACCGTCCCCTCTGGCGTACATGTTGAGCCTCTACCGAGACCCTCTGCCT
CGGGCGGACATCATCCGCAGCCTCCAGGCGCAAGATGTGGATGTGACTGGGCAGAACTGGACCT
TCACGTTTGACTTCTCCTTTTTGAGCCAAGAAGAGGATCTGGTATGGGCGGAGCTCCGGTTGCA
GCTGCTCAGCCCTATGGACAGCCCCACCAAGGGTCCACTCACCATTGACATTTTCCACCAGGCC
AAGCCGGATCCAGAGCAGGACCCGGCTGACTGCCTGGAGCGTGTTTGGATGGAGAGGATCACCG
TCACTCCTTCTCAGGTCACGTTTGCCTCAGACAGCACAGTCCTAGAGGTGACCAAGCCACTCTC
CAAGTGGCTAAAGGACCCCAGGGCACTGGAGAAGCAGGTGTCCAGTCAAGCAGGAAAGTGTTGG
CATCAGTCCCACACCCAGCCTGTCCCTGTCACCAGTACCAGTGTGCTCATGCTTTACTCCAACC
GGCCTCAGGAGCAGAGGCAGCTGGGGGGCGCCACTTTGCTCTGGGAAGCGGAGAGCTCCTGGCG
GGCCCAGGAGGGACAGCTGTCCGTAGAGAGGAGTGGATGGGGCAGAAGGCAACGCCGCCATCAT
TTGCCAGACAGAAGCCAACTATGTAGGAGGGTCAAGTTCCAGGTGGACTTCAACCTGATTGGCT
GGGGCTCCTGGATCATCTACCCGAAGCAGTACAATGCCTATCGCTGTGAGGGCGAGTGTCCTAA
CCCTGTGGGGGAGGAGTTTCACCCTACCAACCACGCCTATATCCAGAGCCTGCTGAAACGTTAC
CAGCCCCACCGGGTTCCTTCTACATGCTGTGCTCCCGTGAAGACCAAGCCACTGAGCATGCTTT
ATGTGGACAATGGCAGGGTCCTCCTGGAACACCACAAGGACATGATTGTGGAGGAGTGTGGGTG
CCTCTGACAGAGCCAGGAGGAATGCTGAATCATCGGCTTGCCCTCCACAATGCTGGTGAACTCT
AAGGAGACTCCATTGTGTCTATCCGGGGAGCAGAAGTGGAAGAGCTCTGCCTGCTGGAGCTATA
GGAGAAGGCCCCGCCCCCTGTGCATACAGGGCTCTTAGACCCAACAAGCCAGAGGCTACTGTGG
GAAGGCAGGATTGGGAAGCCTTGCAAGGGCTGGCTGGGCTCCCTGGAAACAGAGTTTATGAACT
GCTTAAAAGTGTGCAAAGGCTGGAGTGTATATTATATATATATGTATTTATTTTTGAGGCCATC
TGTAGCTTTTTTGTATTCTCAAAAGTGGTCTGTGACCTGCTGTCCCTCCCTCAAGATTAGTATA
ATTTTATTAGATTAAAACTAGCCATTTCGCTCTCCCTGCTTCAAGCTGGGCTAGGGGAGCCCCA
CAACTTTTTGGCTGGCTGACTGGCAGTGACAAGCTGGCCTTGGTCAGGGTCTCTCTGATCTCCA
ATGAGTTGCCTAAACAATAAAGTCACTGTCCAGTTCTCCAGGGCCAGCTGGTGCCTTTGGCCAG
AAAGGTGGGCACTTGTCCAAGAGGGGACTGGCCATGGTGGACTTTAGAAGCCAGAGCCCTCGGA
TGTCTGCTTGGCAGACACAACCCAAGTCTATTAAAAGTCAGTGACAATTC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001099864	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL93025	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000000672
	ENSRNOP00000000672.2

RefSeq Acc Id:	NP_001099864 ⟸ NM_001106394
- Peptide Label:	precursor
- UniProtKB:	D3ZGK9 (UniProtKB/TrEMBL), A6K3Z7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSVHCLPVLLLQTCWTLLHPRVATAAALPLWTRGQPSSPSPLAYMLSLYRDPLPRADIIRSLQA QDVDVTGQNWTFTFDFSFLSQEEDLVWAELRLQLLSPMDSPTKGPLTIDIFHQAKPDPEQDPAD CLERVWMERITVTPSQVTFASDSTVLEVTKPLSKWLKDPRALEKQVSSQAGKCWHQSHTQPVPV TSTSVLMLYSNRPQEQRQLGGATLLWEAESSWRAQEGQLSVERSGWGRRQRRHHLPDRSQLCRR VKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCC APVKTKPLSMLYVDNGRVLLEHHKDMIVEECGCL hide sequence

Ensembl Acc Id:

ENSRNOP00000000672 ⟸ ENSRNOT00000000672

Protein Domains

TGF-beta family profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZGK9-F1-model_v2	AlphaFold	D3ZGK9	1-354	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305994	AgrOrtholog
BioCyc Gene	G2FUF-3723	BioCyc
Ensembl Genes	ENSRNOG00000000556	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000000672	ENTREZGENE
	ENSRNOT00000000672.6	UniProtKB/TrEMBL
Gene3D-CATH	2.10.90.10	UniProtKB/TrEMBL
	2.60.120.970	UniProtKB/TrEMBL
InterPro	Cystine-knot_cytokine	UniProtKB/TrEMBL
	TGF-b_C	UniProtKB/TrEMBL
	TGF-beta-rel	UniProtKB/TrEMBL
	TGFb_CS	UniProtKB/TrEMBL
KEGG Report	rno:294503	UniProtKB/TrEMBL
NCBI Gene	294503	ENTREZGENE
PANTHER	NODAL HOMOLOG	UniProtKB/TrEMBL
	TGFbeta	UniProtKB/TrEMBL
Pfam	TGF_beta	UniProtKB/TrEMBL
PhenoGen	Nodal	PhenoGen
PROSITE	TGF_BETA_1	UniProtKB/TrEMBL
	TGF_BETA_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000000556	RatGTEx
SMART	TGFB	UniProtKB/TrEMBL
Superfamily-SCOP	SSF57501	UniProtKB/TrEMBL
UniProt	A6K3Z7	ENTREZGENE, UniProtKB/TrEMBL
	D3ZGK9	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-12-18	Nodal	nodal growth differentiation factor	Nodal	nodal homolog (mouse)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-26	Nodal	nodal homolog (mouse)	Nodal	nodal	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-11	Nodal	nodal	Nodal	nodal homolog (mouse)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-06	Nodal	nodal homolog (mouse)	Nodal_predicted	nodal homolog (mouse) (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Nodal_predicted	nodal homolog (mouse) (predicted)		nodal (predicted)	Name updated	1299863	APPROVED
2005-01-12	Nodal_predicted	nodal (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)