Advanced Search (OLGA)

Gene: Dbf4 (DBF4-CDC7 kinase regulatory subunit) Rattus norvegicus

Analyze

Symbol:

Dbf4

Name:

DBF4-CDC7 kinase regulatory subunit

RGD ID:

1305854

Description:

Predicted to enable protein serine/threonine kinase activator activity. Predicted to be involved in positive regulation of nuclear cell cycle DNA replication and regulation of cell cycle phase transition. Predicted to be located in nucleus. Predicted to be part of Dbf4-dependent protein kinase complex. Orthologous to human DBF4 (DBF4-CDC7 kinase regulatory subunit); PARTICIPATES IN cell cycle pathway, mitotic; INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

DBF4 homolog; DBF4 homolog (S. cerevisiae); DBF4 zinc finger; LOC100912278; LOC103690019; LOC312046; protein DBF4 homolog A; protein DBF4 homolog A-like; RGD1305854; similar to DBF4-related protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DBF4 (DBF4-CDC7 kinase regulatory subunit)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Dbf4 (DBF4 zinc finger)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Dbf4 (DBF4-CDC7 kinase regulatory subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DBF4 (DBF4-CDC7 kinase regulatory subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DBF4 (DBF4 zinc finger)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Dbf4 (DBF4-CDC7 kinase regulatory subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DBF4 (DBF4-CDC7 kinase regulatory subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DBF4 (DBF4-CDC7 kinase regulatory subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Dbf4 (DBF4-CDC7 kinase regulatory subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Dbf4 (DBF4-CDC7 kinase regulatory subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Dbf4 (DBF4 zinc finger)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	DBF4 (DBF4-CDC7 kinase regulatory subunit)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	dbf4 (DBF4 zinc finger)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	DBF4	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER)
Saccharomyces cerevisiae (baker's yeast):	DBF4	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Drosophila melanogaster (fruit fly):	chif	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	chif	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	dbf4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	26,631,491 - 26,656,080 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	26,631,514 - 26,656,562 (+)	Ensembl				GRCr8
mRatBN7.2	4	25,676,570 - 25,701,152 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	25,676,634 - 25,701,066 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	30,666,368 - 30,690,789 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	26,592,600 - 26,617,020 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	24,966,510 - 24,990,871 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	22,898,527 - 22,914,091 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	22,898,527 - 22,914,177 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	22,594,056 - 22,617,580 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	22,522,387 - 22,547,180 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	21,162,668 - 21,187,012 (+)	NCBI		Celera
RGSC_v3.1	4	22,522,504 - 22,554,536 (-)	NCBI
Cytogenetic Map	4	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (ISO)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,2'-Methylenebis(4-methyl-6-tert-butylphenol) (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,4'-trichlorobiphenyl (ISO)

2-hydroxypropanoic acid (ISO)

4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO)

4-hydroxynon-2-enal (ISO)

4-hydroxyphenyl retinamide (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

acrolein (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP)

bisphenol F (ISO)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

calcitriol (ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

CU-O LINKAGE (ISO)

cyclosporin A (ISO)

DDE (ISO)

deguelin (ISO)

dicrotophos (ISO)

dioxygen (ISO)

Enterolactone (ISO)

equol (ISO)

etoposide (ISO)

formaldehyde (ISO)

FR900359 (ISO)

geraniol (ISO)

GW 4064 (ISO)

hydrogen peroxide (ISO)

irinotecan (ISO)

lead diacetate (ISO)

lead(0) (ISO)

lidocaine (EXP)

melphalan (ISO)

mitomycin C (ISO)

mono(2-ethylhexyl) phthalate (ISO)

monobenzyl phthalate (ISO)

Monobutylphthalate (ISO)

monoethyl phthalate (ISO)

N-(6-acetamidohexyl)acetamide (ISO)

nickel atom (ISO)

okadaic acid (ISO)

ozone (ISO)

paclitaxel (ISO)

paracetamol (EXP,ISO)

PCB138 (ISO)

phenobarbital (ISO)

picoxystrobin (ISO)

pirinixic acid (ISO)

piroxicam (ISO)

poly(propylene imine) macromolecule (ISO)

pyrimidifen (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

rotenone (ISO)

silver(1+) nitrate (ISO)

simvastatin (ISO)

sunitinib (ISO)

testosterone (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

toluene 2,4-diisocyanate (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

trimellitic anhydride (ISO)

triptonide (ISO)

trovafloxacin (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

positive regulation of nuclear cell cycle DNA replication (IBA)

regulation of cell cycle phase transition (IBA)

Cellular Component

Dbf4-dependent protein kinase complex (IBA)

nuclear body (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IEA,ISO)

Molecular Function

metal ion binding (IEA)

nucleic acid binding (IEA)

protein binding (ISO)

protein serine/threonine kinase activator activity (IBA)

zinc ion binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

cell cycle pathway, mitotic (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:11250080

Genomics

Comparative Map Data

Dbf4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	26,631,491 - 26,656,080 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	26,631,514 - 26,656,562 (+)	Ensembl				GRCr8
mRatBN7.2	4	25,676,570 - 25,701,152 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	25,676,634 - 25,701,066 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	30,666,368 - 30,690,789 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	26,592,600 - 26,617,020 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	24,966,510 - 24,990,871 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	22,898,527 - 22,914,091 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	22,898,527 - 22,914,177 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	22,594,056 - 22,617,580 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	22,522,387 - 22,547,180 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	21,162,668 - 21,187,012 (+)	NCBI		Celera
RGSC_v3.1	4	22,522,504 - 22,554,536 (-)	NCBI
Cytogenetic Map	4	q12	NCBI

DBF4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	87,876,493 - 87,909,553 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	87,876,216 - 87,909,553 (+)	Ensembl			hg38	GRCh38
GRCh37	7	87,505,808 - 87,538,868 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	87,343,480 - 87,376,792 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	7	82,210,104 - 82,243,416 (+)	NCBI		Celera
Cytogenetic Map	7	q21.12	NCBI
HuRef	7	82,115,419 - 82,148,733 (+)	NCBI		HuRef
CHM1_1	7	87,435,710 - 87,469,023 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	89,126,406 - 89,159,470 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	86,836,862 - 86,870,174 (+)	NCBI

Dbf4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	8,446,969 - 8,472,789 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	8,446,973 - 8,472,716 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	8,396,969 - 8,422,725 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	8,396,973 - 8,422,716 (-)	Ensembl			mm10	GRCm38
MGSCv37	5	8,397,011 - 8,422,606 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	8,403,017 - 8,428,612 (-)	NCBI		MGSCv36	mm8
Celera	5	8,317,304 - 8,342,900 (-)	NCBI		Celera
Cytogenetic Map	5	A1	NCBI
cM Map	5	3.43	NCBI

Dbf4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955432	5,245,116 - 5,265,923 (+)	Ensembl
ChiLan1.0	NW_004955432	5,245,039 - 5,266,104 (+)	NCBI	ChiLan1.0	ChiLan1.0

DBF4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	105,758,069 - 105,789,719 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	154,022,707 - 154,054,300 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	79,872,955 - 79,904,778 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	93,521,636 - 93,553,134 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	93,521,856 - 93,552,920 (+)	Ensembl			panPan2	panpan1.1

DBF4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	14	13,983,832 - 14,019,917 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	14	13,803,576 - 14,019,704 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	14	13,555,264 - 13,591,239 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	13,748,680 - 13,784,872 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	14	13,748,590 - 13,784,872 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	14	13,952,327 - 13,988,505 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	14	13,678,096 - 13,714,258 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	14	13,963,669 - 13,999,860 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Dbf4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	27,014,211 - 27,038,199 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936763	963,195 - 986,926 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936763	963,195 - 987,198 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DBF4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	92,448,738 - 92,481,379 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	9	92,449,385 - 92,481,959 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	101,840,273 - 101,871,578 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DBF4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	61,029,913 - 61,062,806 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	61,029,498 - 61,062,433 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666042	43,012,707 - 43,045,596 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dbf4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624809	5,471,230 - 5,493,974 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624809	5,471,056 - 5,494,188 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Dbf4
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	6	140,298,568 - 140,323,417 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Dbf4
145 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	330
Count of miRNA genes:	149
Interacting mature miRNAs:	170
Transcripts:	ENSRNOT00000011351, ENSRNOT00000072455
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2302371	Stl22	Serum triglyceride level QTL 22	5.15		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	13080146	58080146	Rat
2303585	Bw86	Body weight QTL 86	4		body mass (VT:0001259)	body weight (CMO:0000012)	4	15644309	60644309	Rat
8552903	Pigfal2	Plasma insulin-like growth factor 1 level QTL 2	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	4	1	32668025	Rat
724557	Plsm1	Polydactyly-luxate syndrome (PLS) morphotypes QTL 1		0.0003	forelimb integrity trait (VT:0010562)	front foot phalanges count (CMO:0001947)	4	1	28392287	Rat
9590100	Sffal4	Serum free fatty acids level QTL 4	7.36	0.05	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	4	1	32668025	Rat
8552906	Pigfal3	Plasma insulin-like growth factor 1 level QTL 3			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	4	11038706	56038706	Rat
1357341	Gluco5	Glucose level QTL 5	6.4		adipocyte free fatty acid secretion trait (VT:0010465)	absolute change in adipocyte free fatty acid secretion per unit volume (CMO:0001446)	4	1	34142783	Rat
1357343	Gluco4	Glucose level QTL 4		0.00002	adipocyte glucose uptake trait (VT:0004185)	adipocyte maximal glucose uptake to basal glucose uptake ratio (CMO:0000874)	4	1	34142783	Rat
8552782	Vie1	Viral induced encephalitis QTL 1	26.4		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	1	35396961	Rat
6478766	Anxrr47	Anxiety related response QTL 47		0.09637	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	11038706	56038706	Rat
70222	Eae2	Experimental allergic encephalomyelitis QTL 2	4.3		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	4	22288453	40471598	Rat
61330	Eau1	Experimental allergic uveoretinitis QTL 1		0.0003	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	4	26234499	134199155	Rat
631642	Stl2	Serum triglyceride level QTL 2	3.3		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5894575	57613242	Rat
6478769	Anxrr48	Anxiety related response QTL 48		0.02514	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	11038706	56038706	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	11706604	92690519	Rat
61333	Gluco16	Glucose level QTL 16	4.3	0.00001	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	1	31106810	Rat
2313401	Anxrr27	Anxiety related response QTL 27			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	4	18900697	63900697	Rat
61408	Scl23	Serum cholesterol level QTL 23		0.0005	blood HDL phospholipid amount (VT:0010504)	serum high density lipoprotein phospholipid level (CMO:0001567)	4	1	28392287	Rat
631209	Bw2	Body weight QTL2	4.2		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	1	45429897	Rat
8552803	Bw144	Body weight QTL 144	16		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	4	1	35396961	Rat
8694374	Bw155	Body weight QTL 155	3.39	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	4	11038706	56038706	Rat
8552801	Bw143	Body weight QTL 143	7.3		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	4	1	35396961	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5889999	148002343	Rat
9589046	Scfw2	Subcutaneous fat weight QTL 2	5.54	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	4	1	32668025	Rat
61412	Pia2	Pristane induced arthritis QTL 2	3.9		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	4	22288453	63245191	Rat
8552807	Vie4	Viral induced encephalitis QTL 4	7.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	18900697	63900697	Rat
6478724	Anxrr35	Anxiety related response QTL 35		0.00449	defecation behavior trait (VT:0010462)	defecation measurement (CMO:0000997)	4	11038706	56038706	Rat
61351	Bp33	Blood pressure QTL 33		0.0018	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	1	28392287	Rat
61415	Eae11	Experimental allergic encephalomyelitis QTL 11	2.9		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	4	1	40471598	Rat
1641905	Colcr1	Colorectal carcinoma resistance QTL 1	4.3	0.0003	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	4	8428551	30449094	Rat
619616	Bp79	Blood pressure QTL 79		0.0292	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	5889999	50889999	Rat
8552809	Vie5	Viral induced encephalitis QTL 5	25.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	1	35396961	Rat
7387227	Uae40	Urinary albumin excretion QTL 40	2.9	0.0052	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	18913151	63913151	Rat
738021	Hcar13	Hepatocarcinoma resistance QTL 13	4.3		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	4	1	33538816	Rat
1358203	Stl19	Serum triglyceride level QTL 19	2.8	0.002	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	21925151	66925151	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	4	1	63900697	Rat
9590304	Scort17	Serum corticosterone level QTL 17	4.96	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	11038706	56038706	Rat
9589097	Slep11	Serum leptin concentration QTL 11	5.09	0.001	blood leptin amount (VT:0005667)	plasma leptin level (CMO:0000781)	4	1	32668025	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	12212457	182430611	Rat
1354665	Stl10	Serum triglyceride level QTL 10	3.57		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	22288453	45429897	Rat
1300141	Bp178	Blood pressure QTL 178			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	10758701	40490708	Rat

Markers in Region

BF393841

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	25,672,222 - 25,672,364 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	22,657,499 - 22,657,640	NCBI	Rnor6.0
Rnor_5.0	4	22,589,484 - 22,589,625	UniSTS	Rnor5.0
RGSC_v3.4	4	22,551,473 - 22,551,614	UniSTS	RGSC3.4
Celera	4	21,158,234 - 21,158,375	UniSTS
RH 3.4 Map	4	169.0	UniSTS
Cytogenetic Map	4	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	10	66	162	91	90	59	92	59	6	352	190	11	141	80	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001191748	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107501	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107502	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107503	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233188	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000011351

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	4	22,662,216 - 22,685,474 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000072455 ⟹ ENSRNOP00000065840

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	26,631,514 - 26,656,562 (+)	Ensembl
mRatBN7.2 Ensembl	4	25,676,634 - 25,698,351 (+)	Ensembl
Rnor_6.0 Ensembl	4	22,898,527 - 22,913,973 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000076123 ⟹ ENSRNOP00000068111

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	26,631,514 - 26,656,562 (+)	Ensembl
mRatBN7.2 Ensembl	4	25,676,657 - 25,701,066 (+)	Ensembl
Rnor_6.0 Ensembl	4	22,898,527 - 22,914,177 (+)	Ensembl

RefSeq Acc Id:

NM_001191748 ⟹ NP_001178677

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	26,631,586 - 26,655,994 (+)	NCBI
mRatBN7.2	4	25,676,657 - 25,701,066 (+)	NCBI
Rnor_6.0	4	22,898,527 - 22,914,091 (+)	NCBI
Rnor_5.0	4	22,594,056 - 22,617,580 (+)	NCBI
Celera	4	21,162,668 - 21,187,012 (+)	NCBI

Sequence:

show sequence

CGCGCCGGAACCGGCCCTGAAACTCGGCCAGCGGACGCCGCCCGGCGCCGAGGCCAGGGCCGGT
GGGCCTGTGGGAGGTTTGTGTGCGGGGCCGTCCCATGCGGCCCCCGGTGCGGGCCAGCATGTAG
GTGCTTGGTGGCTGCCATGAACCTCGAGACCATGAGGATCCACAGCAAAGCACCTCTCCCTGGT
GGCATCCAAGACAAAAATGAAAAGAATAGACCATCTTTGAAATCCCTGAAAGCTGATAATAGAC
TGGAAAAATCCAAATATAAGCCGCTTTGGGGGAAAATATTTTACCTTGACTTGCCTTCTATCAC
CATATGTGAAAAACTCCAAAAAGACATAAAGGAACTTGGAGGGCGAGTTGAAGAATTTCTCAGC
AAAGATATCAGTTATCTTGTTTCAAATAAAAAGGAAGCAAAGTATGCACAAACGTTGGGTCGAG
TTTCTCCTGTACCAAGTCCGGAATCTGCATATACTGCGGAAACCACCTCCCCTCATCCCAGCCA
TGATGGAAGCTCCTTTAAGTCTCAAGACAGAGTGTGTTTGAGCCGAGGAAAGTTGTTAGCTGAG
AAAGCTGTCAAGGATCATGATTTTATTCCTGCTAATAGTATATTATCAAACGCCTTATCATGGG
GAGTAAAGATTCTTCATATTGATGACATTCGCTACTACATTGAACAGAAGAAGAAAGCTTTGGG
TGCACTCAAGAAACCAAATACTTCTGGGAGGGATTCGGGGAAAAAAGCTGGTACTGGAATACAA
AAAGCAAGAACAGGGAGACTCAAGAAGCCGTTTTTAAAGGTTGAAGATGTGAACCGGACTTACA
AGCCATTTTACCTTCAGCTCCCCAGTATGCCTTGTATAAACTACTTCCTTCAGAAGCCTTGCAG
TCCGTTTGATATCGATAAGTCATCTAGCATGCAGAAACACACTCAGCCTAAACTCAAAATTAAT
ACGGATGGCGATAAATATGGAACCCCAGCTCAAGTCCAGTTGAAGGAAAAGAGAAAAAAAGGAT
ATTGTGAATGTTGCTTGCAGAAATATGAAGATCTTGAAACTCACCTTCTGAGTGAGAAACACAG
GAACTTTGCACAGAGTAACCAGTATCAAGTTGTTGACGATATTGTATCTAAGTTAATTTTTGAT
TTTGTGGAATATGAAAGAGACACACCTAAAAAGAAAAGAATAAGATACAGTGTTGGATCCCTGT
CTTCTGTTTCTGCAAGTGTCCTGCAAAACACTGAACCAAGGGAGAAGCTACTGTTGGAGCCCAG
TTTCCAGAAAGATGGAGAAGAAAGCAATGGACAACTGCTCGAGCAGAATTTACAATGTGAAGAA
ACCCAGAAACCTGAAGAAAAGCATGTGTTTGGTTCAGAACCCACAACCTATTCTTCAACTGGAT
TTAAAGGATGTGTTGGGAAACCAGTGAGCCTGATAAATGCAAGTGAGCCTGACTTGAAGCCGGA
TTGTGAACAGCTCCCTCTGCGTGACAATAAGCAGGAGGGCATGCGTGTTGGTTCTGAACATAAA
ATAACTGTAGATAGAAAGGATGTAGACCAGAGAGGAGGCGTCACTCCATGTGTGCCACAGTCAT
GTACCTATTTCAGTACGGACAGTAATCTACCCCAACCAAAGTTAACTGCAGACATTACACAGTT
TTCAGCACAAGATCTGCAAGAAAAGGACCTTCATGTGATTGGTCATGATTCTGAGCTGGTGACG
TTGAATTCATCAAGAGAGCAGCTAACAGTGAAGGCCAGACCTCCACCCTGTAGTCCTCAGGAGC
CTCATGAGGGTCACAGTGAGCATATGGAGAGTCTGCCTTGTGGTAAAATCCAGCGGAAAGTGAG
AATGTTATTAGGGCAAAAGAAAGCAAATGTGGAACCTGGTGCCGAATGGGATAAGAACAGAACT
GAGTATCTTCCTGCACATGGAGACAGAACTTGTGGGTCACCAGTACAGTCTCTGTTGGACCTTT
TTCAGACAAGCGGGGAGAAATCAGAATTTTTGGGTTTTACAAGCTACACTGAAAACAGTGGAAT
CTGTGATGTTTTAGATATTTGGGAGGAAGACAATTCAAGTAGCCTGTTGTCAACATTTTTTTCT
TCCCCTTCAACTTCTGCATTTGTTGGATTTTAGTATTTAATGTGATTTTCAGAAGTGACAGCTA
TATTCCTGGAGTTTTTATAAATACGTATATAATTAGGAGTTGGGGAGGGTTGTTTTTGTCAACT
TTGTTTATGGAACCGTCTGTAAA

hide sequence

RefSeq Acc Id:

XM_039107501 ⟹ XP_038963429

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	26,631,491 - 26,656,080 (+)	NCBI
mRatBN7.2	4	25,676,570 - 25,701,152 (+)	NCBI

RefSeq Acc Id:

XM_039107502 ⟹ XP_038963430

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	26,632,872 - 26,656,080 (+)	NCBI
mRatBN7.2	4	25,677,947 - 25,701,152 (+)	NCBI

RefSeq Acc Id:

XM_039107503 ⟹ XP_038963431

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	26,646,343 - 26,656,080 (+)	NCBI
mRatBN7.2	4	25,691,383 - 25,701,152 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001178677	(Get FASTA)	NCBI Sequence Viewer
	XP_038963429	(Get FASTA)	NCBI Sequence Viewer
	XP_038963430	(Get FASTA)	NCBI Sequence Viewer
	XP_038963431	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL84322	(Get FASTA)	NCBI Sequence Viewer
	EDL84323	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000065840.3
	ENSRNOP00000068111
	ENSRNOP00000068111.2

RefSeq Acc Id:

NP_001178677 ⟸ NM_001191748

- UniProtKB:

A0A096MJF6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MNLETMRIHSKAPLPGGIQDKNEKNRPSLKSLKADNRLEKSKYKPLWGKIFYLDLPSITICEKL
QKDIKELGGRVEEFLSKDISYLVSNKKEAKYAQTLGRVSPVPSPESAYTAETTSPHPSHDGSSF
KSQDRVCLSRGKLLAEKAVKDHDFIPANSILSNALSWGVKILHIDDIRYYIEQKKKALGALKKP
NTSGRDSGKKAGTGIQKARTGRLKKPFLKVEDVNRTYKPFYLQLPSMPCINYFLQKPCSPFDID
KSSSMQKHTQPKLKINTDGDKYGTPAQVQLKEKRKKGYCECCLQKYEDLETHLLSEKHRNFAQS
NQYQVVDDIVSKLIFDFVEYERDTPKKKRIRYSVGSLSSVSASVLQNTEPREKLLLEPSFQKDG
EESNGQLLEQNLQCEETQKPEEKHVFGSEPTTYSSTGFKGCVGKPVSLINASEPDLKPDCEQLP
LRDNKQEGMRVGSEHKITVDRKDVDQRGGVTPCVPQSCTYFSTDSNLPQPKLTADITQFSAQDL
QEKDLHVIGHDSELVTLNSSREQLTVKARPPPCSPQEPHEGHSEHMESLPCGKIQRKVRMLLGQ
KKANVEPGAEWDKNRTEYLPAHGDRTCGSPVQSLLDLFQTSGEKSEFLGFTSYTENSGICDVLD
IWEEDNSSSLLSTFFSSPSTSAFVGF

hide sequence

Ensembl Acc Id:

ENSRNOP00000065840 ⟸ ENSRNOT00000072455

Ensembl Acc Id:

ENSRNOP00000068111 ⟸ ENSRNOT00000076123

RefSeq Acc Id:	XP_038963429 ⟸ XM_039107501
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038963430 ⟸ XM_039107502
- Peptide Label:	isoform X2
- UniProtKB:	A6K240 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038963431 ⟸ XM_039107503
- Peptide Label:	isoform X2
- UniProtKB:	A6K240 (UniProtKB/TrEMBL)

Protein Domains

BRCT DBF4-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-M0R8P0-F1-model_v2	AlphaFold	M0R8P0	1-594	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305854	AgrOrtholog
BioCyc Gene	G2FUF-45822	BioCyc
Ensembl Genes	ENSRNOG00000008513	Ensembl
	ENSRNOG00000050482	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000072455.4	UniProtKB/TrEMBL
	ENSRNOT00000076123	ENTREZGENE
	ENSRNOT00000076123.4	UniProtKB/TrEMBL
Gene3D-CATH	2.10.50.40	UniProtKB/TrEMBL
	6.10.250.3410	UniProtKB/TrEMBL
InterPro	BRCT_dom	UniProtKB/TrEMBL
	BRCT_dom_sf	UniProtKB/TrEMBL
	Replication_Regulatory_Kinase	UniProtKB/TrEMBL
	RUNDC3A_B	UniProtKB/TrEMBL
	Znf_DBF	UniProtKB/TrEMBL
	Znf_DBF_sf	UniProtKB/TrEMBL
KEGG Report	rno:312046	UniProtKB/TrEMBL
NCBI Gene	312046	ENTREZGENE
PANTHER	ACTIVATOR OF S-PHASE KINASE-RELATED	UniProtKB/TrEMBL
	PROTEIN DBF4 HOMOLOG A	UniProtKB/TrEMBL
	RUN DOMAIN-CONTAINING 3 PROTEIN RUNDC3	UniProtKB/TrEMBL
	RUN DOMAIN-CONTAINING PROTEIN 3B	UniProtKB/TrEMBL
Pfam	zf-DBF	UniProtKB/TrEMBL
PhenoGen	Dbf4	PhenoGen
PROSITE	BRCT	UniProtKB/TrEMBL
	ZF_DBF4	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000008513	RatGTEx
	ENSRNOG00000050482	RatGTEx
SMART	ZnF_DBF	UniProtKB/TrEMBL
Superfamily-SCOP	SSF52113	UniProtKB/TrEMBL
UniProt	A0A096MJF6	ENTREZGENE, UniProtKB/TrEMBL
	A6K240	ENTREZGENE, UniProtKB/TrEMBL
	M0R8P0_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2024-01-08	Dbf4	DBF4-CDC7 kinase regulatory subunit	Dbf4	DBF4 zinc finger	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2021-03-09	Dbf4	DBF4 zinc finger	LOC103690019	protein DBF4 homolog A-like	Data merged from RGD:9449239	737654	PROVISIONAL
2015-07-29	Dbf4	DBF4 zinc finger	LOC100912278	protein DBF4 homolog A-like	Data merged from RGD:6488169	737654	PROVISIONAL
2014-08-25	LOC103690019	protein DBF4 homolog A-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2014-03-07	Dbf4	DBF4 zinc finger	Dbf4	DBF4 homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-07-05	LOC100912278	protein DBF4 homolog A-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-03-07	Dbf4	DBF4 homolog (S. cerevisiae)	RGD1305854_predicted	similar to DBF4-related protein (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	RGD1305854_predicted	similar to DBF4-related protein (predicted)	LOC312046_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC312046_predicted	similar to DBF4-related protein (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Annotations - KEGG (archival)