Symbol:
Tex261
Name:
testis expressed 261
RGD ID:
1305851
Description:
Predicted to enable COPII receptor activity. Predicted to be involved in endoplasmic reticulum to Golgi vesicle-mediated transport. Predicted to act upstream of or within positive regulation of apoptotic process. Predicted to be located in cytoplasm and membrane. Predicted to be active in COPII-coated ER to Golgi transport vesicle; Golgi membrane; and endoplasmic reticulum membrane. Orthologous to human TEX261 (testis expressed 261); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrotoluene; amiodarone.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC297392; MGC109238; testis expressed gene 261
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TEX261 (testis expressed 261) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):
Tex261 (testis expressed gene 261) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Tex261 (testis expressed 261) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TEX261 (testis expressed 261) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TEX261 (testis expressed 261) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tex261 (testis expressed 261) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TEX261 (testis expressed 261) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TEX261 (testis expressed 261) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tex261 (testis expressed 261) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ADGRE5 (adhesion G protein-coupled receptor E5) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Tex261 (testis expressed gene 261)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
TEX261 (testis expressed 261)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tex261 (testis expressed 261)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG3500
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
SVP26
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
tex261
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 117,813,050 - 117,818,408 (-) NCBI GRCr8 mRatBN7.2 4 116,253,547 - 116,260,730 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 116,244,600 - 116,260,253 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 121,733,985 - 121,738,938 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 117,509,178 - 117,514,131 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 116,122,826 - 116,127,779 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 115,446,830 - 115,454,035 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 115,448,708 - 115,453,659 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 180,035,954 - 180,042,783 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 117,963,579 - 117,968,532 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 118,208,061 - 118,213,013 (-) NCBI Celera 4 105,247,874 - 105,252,827 (-) NCBI Celera Cytogenetic Map 4 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tex261 Rat 1,2-dimethylhydrazine increases expression ISO Tex261 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of TEX261 mRNA CTD PMID:22206623 Tex261 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Tex261 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TEX261 mRNA CTD PMID:21570461 Tex261 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of TEX261 mRNA CTD PMID:34747641 Tex261 Rat 2,4,6-trinitrotoluene affects expression EXP 6480464 Trinitrotoluene affects the expression of TEX261 mRNA CTD PMID:21346803 Tex261 Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO Tex261 (Mus musculus) 6480464 3 more ... CTD PMID:19467301 Tex261 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Tex261 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of TEX261 mRNA CTD PMID:18648102 Tex261 Rat acrylamide decreases expression ISO TEX261 (Homo sapiens) 6480464 Acrylamide results in decreased expression of TEX261 mRNA CTD PMID:32763439 Tex261 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of TEX261 mRNA CTD PMID:18355885 Tex261 Rat amitriptyline affects expression EXP 6480464 Amitriptyline affects the expression of TEX261 mRNA CTD PMID:18355885 Tex261 Rat aristolochic acid A increases expression ISO TEX261 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of TEX261 mRNA CTD PMID:33212167 Tex261 Rat arsenous acid increases expression ISO TEX261 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of TEX261 mRNA CTD PMID:20458559 Tex261 Rat atrazine decreases expression ISO TEX261 (Homo sapiens) 6480464 Atrazine results in decreased expression of TEX261 mRNA CTD PMID:22378314 Tex261 Rat azathioprine increases expression ISO Tex261 (Mus musculus) 6480464 Azathioprine results in increased expression of TEX261 mRNA CTD PMID:21621594 Tex261 Rat benzo[a]pyrene increases expression ISO Tex261 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of TEX261 mRNA CTD PMID:22228805 Tex261 Rat beta-lapachone increases expression ISO TEX261 (Homo sapiens) 6480464 beta-lapachone results in increased expression of TEX261 mRNA CTD PMID:38218311 Tex261 Rat bisphenol A increases expression ISO Tex261 (Mus musculus) 6480464 bisphenol A results in increased expression of TEX261 mRNA CTD PMID:26063408 and PMID:33221593 Tex261 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TEX261 mRNA CTD PMID:30816183 and PMID:34947998 Tex261 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TEX261 mRNA CTD PMID:25181051 Tex261 Rat bisphenol F increases expression ISO Tex261 (Mus musculus) 6480464 bisphenol F results in increased expression of TEX261 mRNA CTD PMID:38685157 Tex261 Rat cadmium dichloride decreases expression ISO TEX261 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of TEX261 mRNA CTD PMID:38568856 Tex261 Rat CGP 52608 multiple interactions ISO TEX261 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to TEX261 gene] CTD PMID:28238834 Tex261 Rat chlorpyrifos increases expression ISO Tex261 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of TEX261 mRNA CTD PMID:37019170 Tex261 Rat clomipramine affects expression EXP 6480464 Clomipramine affects the expression of TEX261 mRNA CTD PMID:18355885 Tex261 Rat copper(II) sulfate decreases expression ISO TEX261 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of TEX261 mRNA CTD PMID:19549813 Tex261 Rat dexamethasone decreases expression ISO Tex261 (Mus musculus) 6480464 Dexamethasone results in decreased expression of TEX261 mRNA CTD PMID:21621594 Tex261 Rat diarsenic trioxide increases expression ISO TEX261 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of TEX261 mRNA CTD PMID:20458559 Tex261 Rat Dibutyl phosphate affects expression ISO TEX261 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of TEX261 mRNA CTD PMID:37042841 Tex261 Rat dioxygen decreases expression ISO Tex261 (Mus musculus) 6480464 Oxygen deficiency results in decreased expression of TEX261 mRNA CTD PMID:24205000 Tex261 Rat dorsomorphin multiple interactions ISO TEX261 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TEX261 mRNA CTD PMID:27188386 Tex261 Rat doxorubicin decreases expression ISO TEX261 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of TEX261 mRNA CTD PMID:29803840 Tex261 Rat ethanol affects splicing ISO Tex261 (Mus musculus) 6480464 Ethanol affects the splicing of TEX261 mRNA CTD PMID:30319688 Tex261 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of TEX261 mRNA CTD PMID:24136188 Tex261 Rat fluoranthene multiple interactions ISO Tex261 (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in decreased expression of TEX261 mRNA CTD PMID:28329830 Tex261 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of TEX261 mRNA CTD PMID:24136188 Tex261 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of TEX261 mRNA CTD PMID:24793618 Tex261 Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of TEX261 mRNA CTD PMID:24136188 Tex261 Rat imipramine affects expression EXP 6480464 Imipramine affects the expression of TEX261 mRNA CTD PMID:18355885 Tex261 Rat inulin multiple interactions ISO Tex261 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of TEX261 mRNA CTD PMID:36331819 Tex261 Rat ketoconazole affects expression EXP 6480464 Ketoconazole affects the expression of TEX261 mRNA CTD PMID:18355885 Tex261 Rat lead(0) affects expression ISO TEX261 (Homo sapiens) 6480464 Lead affects the expression of TEX261 mRNA CTD PMID:28903495 Tex261 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of TEX261 mRNA CTD PMID:24136188 Tex261 Rat methotrexate increases expression ISO Tex261 (Mus musculus) 6480464 Methotrexate results in increased expression of TEX261 mRNA CTD PMID:21621594 Tex261 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of TEX261 mRNA CTD PMID:24136188 Tex261 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of TEX261 mRNA CTD PMID:24136188 Tex261 Rat nitrates multiple interactions ISO Tex261 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of TEX261 mRNA CTD PMID:35964746 Tex261 Rat paracetamol affects expression ISO Tex261 (Mus musculus) 6480464 Acetaminophen affects the expression of TEX261 mRNA CTD PMID:17562736 Tex261 Rat paracetamol increases expression ISO TEX261 (Homo sapiens) 6480464 Acetaminophen results in increased expression of TEX261 mRNA CTD PMID:22230336 Tex261 Rat pentachlorophenol increases expression ISO Tex261 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of TEX261 mRNA CTD PMID:23892564 Tex261 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Tex261 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of TEX261 mRNA CTD PMID:36331819 Tex261 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of TEX261 mRNA CTD PMID:19162173 Tex261 Rat prednisolone decreases expression ISO Tex261 (Mus musculus) 6480464 Prednisolone results in decreased expression of TEX261 mRNA CTD PMID:21621594 Tex261 Rat SB 431542 multiple interactions ISO TEX261 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TEX261 mRNA CTD PMID:27188386 Tex261 Rat sodium arsenate increases expression ISO Tex261 (Mus musculus) 6480464 sodium arsenate results in increased expression of TEX261 mRNA CTD PMID:30953684 Tex261 Rat sodium arsenite decreases expression ISO TEX261 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of TEX261 mRNA CTD PMID:38568856 Tex261 Rat sodium dodecyl sulfate decreases expression ISO Tex261 (Mus musculus) 6480464 Sodium Dodecyl Sulfate results in decreased expression of TEX261 mRNA CTD PMID:21621594 Tex261 Rat Soman increases expression EXP 6480464 Soman results in increased expression of TEX261 mRNA CTD PMID:19281266 Tex261 Rat titanium dioxide decreases methylation ISO TEX261 (Homo sapiens) 6480464 titanium dioxide results in decreased methylation of TEX261 gene and titanium dioxide results in decreased methylation of TEX261 promoter CTD PMID:34973136 Tex261 Rat valproic acid affects expression ISO TEX261 (Homo sapiens) 6480464 Valproic Acid affects the expression of TEX261 mRNA CTD PMID:25979313 Tex261 Rat valproic acid increases expression ISO TEX261 (Homo sapiens) 6480464 Valproic Acid results in increased expression of TEX261 mRNA CTD PMID:23179753 more ... Tex261 Rat valproic acid multiple interactions ISO TEX261 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TEX261 mRNA CTD PMID:27188386
1,2-dimethylhydrazine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrotoluene (EXP) 3,3',4,4'-tetrachlorobiphenyl (ISO) 4,4'-diaminodiphenylmethane (ISO) acrylamide (ISO) amiodarone (EXP) amitriptyline (EXP) aristolochic acid A (ISO) arsenous acid (ISO) atrazine (ISO) azathioprine (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium dichloride (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) clomipramine (EXP) copper(II) sulfate (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) ethanol (ISO) finasteride (EXP) fluoranthene (ISO) flutamide (EXP) glafenine (EXP) imipramine (EXP) inulin (ISO) ketoconazole (EXP) lead(0) (ISO) leflunomide (EXP) methotrexate (ISO) nefazodone (EXP) nimesulide (EXP) nitrates (ISO) paracetamol (ISO) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (EXP) prednisolone (ISO) SB 431542 (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium dodecyl sulfate (ISO) Soman (EXP) titanium dioxide (ISO) valproic acid (ISO)
Tex261 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 117,813,050 - 117,818,408 (-) NCBI GRCr8 mRatBN7.2 4 116,253,547 - 116,260,730 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 116,244,600 - 116,260,253 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 121,733,985 - 121,738,938 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 117,509,178 - 117,514,131 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 116,122,826 - 116,127,779 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 115,446,830 - 115,454,035 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 115,448,708 - 115,453,659 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 180,035,954 - 180,042,783 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 117,963,579 - 117,968,532 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 118,208,061 - 118,213,013 (-) NCBI Celera 4 105,247,874 - 105,252,827 (-) NCBI Celera Cytogenetic Map 4 q34 NCBI
TEX261 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 70,985,942 - 70,994,873 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 70,968,325 - 70,994,873 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 71,213,072 - 71,222,003 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 71,066,576 - 71,075,509 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 71,124,724 - 71,133,656 NCBI Celera 2 71,063,750 - 71,072,681 (-) NCBI Celera Cytogenetic Map 2 p13.3 NCBI HuRef 2 70,949,521 - 70,958,453 (-) NCBI HuRef CHM1_1 2 71,142,398 - 71,151,331 (-) NCBI CHM1_1 T2T-CHM13v2.0 2 70,996,958 - 71,005,889 (-) NCBI T2T-CHM13v2.0
Tex261 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 83,745,863 - 83,752,804 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 83,745,867 - 83,752,795 (-) Ensembl GRCm39 Ensembl GRCm38 6 83,768,881 - 83,776,099 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 83,768,885 - 83,775,813 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 83,720,408 - 83,725,806 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 83,736,074 - 83,741,417 (-) NCBI MGSCv36 mm8 Celera 6 85,753,585 - 85,758,986 (-) NCBI Celera Cytogenetic Map 6 C3 NCBI cM Map 6 35.94 NCBI
Tex261 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955424 14,238,105 - 14,246,222 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955424 14,233,322 - 14,246,222 (+) NCBI ChiLan1.0 ChiLan1.0
TEX261 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 55,393,043 - 55,401,944 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 55,396,988 - 55,405,889 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 71,050,226 - 71,060,643 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2A 72,163,645 - 72,172,498 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2A 72,163,645 - 72,172,498 (-) Ensembl panpan1.1 panPan2
TEX261 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 69,294,347 - 69,301,934 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 69,182,944 - 69,189,898 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 70,317,912 - 70,324,896 (-) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 10 70,041,361 - 70,048,337 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 70,298,021 - 70,305,010 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 70,602,962 - 70,609,958 (-) NCBI UU_Cfam_GSD_1.0
Tex261 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024406292 13,407,347 - 13,416,753 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936491 15,154,435 - 15,164,050 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936491 15,154,543 - 15,163,947 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TEX261 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 71,540,380 - 71,548,984 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 71,540,383 - 71,548,993 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 74,991,479 - 75,000,185 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TEX261 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 14 36,120,957 - 36,127,754 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 14 36,121,019 - 36,130,004 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 75,895,157 - 75,904,176 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tex261
.
Predicted Target Of
Count of predictions: 385 Count of miRNA genes: 225 Interacting mature miRNAs: 287 Transcripts: ENSRNOT00000065847 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1582232 Gluco25 Glucose level QTL 25 3.6 0.0023 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 85253748 148090731 Rat 631689 Scl4 Serum cholesterol level QTL 4 1.9 0.008 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 4 95174120 140174120 Rat 1358352 Srcrt3 Stress Responsive Cort QTL 3 2.29 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 38465774 146803430 Rat 1578655 Bmd11 Bone mineral density QTL 11 11 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 4 90850165 135850165 Rat 1300116 Hrtrt5 Heart rate QTL 5 3.76 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 116179486 151161268 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 1357342 Bw40 Body weight QTL 40 0.001 body mass (VT:0001259) body weight (CMO:0000012) 4 76647384 117676292 Rat 631556 Bp135 Blood pressure QTL 135 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 78881294 117676292 Rat 61330 Eau1 Experimental allergic uveoretinitis QTL 1 0.0003 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 4 70362013 132642728 Rat 70167 Bw22 Body weight QTL 22 3.1 body mass (VT:0001259) body weight (CMO:0000012) 4 76647384 117676292 Rat 731165 Uae21 Urinary albumin excretion QTL 21 2.4 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 4 106649412 151649412 Rat 737821 Hcar9 Hepatocarcinoma resistance QTL 9 3.7 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 109866907 167139601 Rat 1549832 Bss3 Bone structure and strength QTL 3 11 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 4 109827074 154827074 Rat 70177 Xhs1 X-ray hypersensitivity QTL 1 25.1 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 82798864 152731274 Rat 724522 Bp146 Blood pressure QTL 146 2.2 0.0021 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 73630210 118630210 Rat 61476 Aia3 Adjuvant induced arthritis QTL 3 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 86730991 131730991 Rat 1641919 Alc22 Alcohol consumption QTL 22 0.0005 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 81192555 126192555 Rat 1354660 Salc1 Saline consumption QTL 1 11.26 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 4 44463908 148090542 Rat 1298082 Stresp4 Stress response QTL 4 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 50119848 146803430 Rat 1578670 Bss14 Bone structure and strength QTL 14 16.4 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 4 87327165 132327165 Rat 70200 Alc18 Alcohol consumption QTL 18 9.2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 4 56647873 149491524 Rat 1331759 Hrtrt13 Heart rate QTL 13 3.54628 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 110275411 168266883 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 1578662 Bss15 Bone structure and strength QTL 15 19.6 femur width (VT:1000666) femoral neck width (CMO:0001695) 4 87327165 132327165 Rat 2302051 Pia28 Pristane induced arthritis QTL 28 5.3 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112) 4 73630210 118630210 Rat 2302049 Pia32 Pristane induced arthritis QTL 32 5.1 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112) 4 105789505 150789505 Rat 6478763 Anxrr46 Anxiety related response QTL 46 0.07428 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 6478760 Anxrr45 Anxiety related response QTL 45 0.06717 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 738009 Sach4 Saccharine consumption QTL 4 4.9 0.000016 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 59948935 154902892 Rat 2312567 Glom19 Glomerulus QTL 19 1.9 0.006 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 4 45456990 146803430 Rat 738015 Pia9 Pristane induced arthritis QTL 9 4.5 0.048 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 80694870 125694870 Rat 7207480 Bss105 Bone structure and strength QTL 105 8.1 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 4 109827074 154827074 Rat 634335 Anxrr16 Anxiety related response QTL 16 7.22 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 93308457 167139447 Rat 631646 Stl4 Serum triglyceride level QTL 4 6.5 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 4 73169846 132642728 Rat 634334 Xhs3 X-ray hypersensitivity QTL 3 10 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 84728680 129854654 Rat 61406 Scwia1 Streptococcal cell wall induced arthritis QTL 1 2.3 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 4 106805662 151805662 Rat 1354612 Foco1 Food consumption QTL 1 8.87 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 4 44463908 148090542 Rat 2303168 Bp330 Blood pressure QTL 330 4.25 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 5214602 146446691 Rat 738031 Alc14 Alcohol consumption QTL 14 7.6 0.00003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1576316 Ept5 Estrogen-induced pituitary tumorigenesis QTL 5 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 4 83428419 177635233 Rat 631662 Hcar2 Hepatocarcinoma resistance QTL 2 3.1 0.0003 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 78878504 123878504 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 61418 Pia5 Pristane induced arthritis QTL 5 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 62277855 128289560 Rat 738016 Alc16 Alcohol consumption QTL 16 3.6 0.00015 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1358202 Gluco11 Glucose level QTL 11 2.4 0.02 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 4 85379421 167139601 Rat 1641833 Alc21 Alcohol consumption QTL 21 8.6 0.0001 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 56698790 126192555 Rat 2306899 Bp338 Blood pressure QTL 338 0.071 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 81006124 120102625 Rat 631674 Iddm14 Insulin dependent diabetes mellitus QTL 14 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 64528739 157573521 Rat 12798519 Anxrr54 Anxiety related response QTL 54 2.54 0.05 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 114627026 159627026 Rat 12798523 Anxrr56 Anxiety related response QTL 56 2.83 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 85253748 150276390 Rat 61434 Cia3 Collagen induced arthritis QTL 3 4.8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 103194656 148194656 Rat
RH127537
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 116,253,686 - 116,253,905 (+) MAPPER mRatBN7.2 Rnor_6.0 4 115,446,966 - 115,447,184 NCBI Rnor6.0 Rnor_5.0 4 180,036,090 - 180,036,308 UniSTS Rnor5.0 RGSC_v3.4 4 117,961,839 - 117,962,057 UniSTS RGSC3.4 Celera 4 105,246,133 - 105,246,351 UniSTS Cytogenetic Map 4 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000065847 ⟹ ENSRNOP00000063367
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 116,244,600 - 116,260,253 (-) Ensembl Rnor_6.0 Ensembl 4 115,448,708 - 115,453,659 (-) Ensembl
RefSeq Acc Id:
NM_001017537 ⟹ NP_001017537
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 117,813,055 - 117,818,008 (-) NCBI mRatBN7.2 4 116,255,427 - 116,260,380 (-) NCBI Rnor_6.0 4 115,448,706 - 115,453,659 (-) NCBI Rnor_5.0 4 180,035,954 - 180,042,783 (-) NCBI RGSC_v3.4 4 117,963,579 - 117,968,532 (-) RGD Celera 4 105,247,874 - 105,252,827 (-) RGD
Sequence:
GGCGGCCCGGGGGGCGCCATGTGGTTCATGTACGTGCTGAGCTGGCTGTCGCTGTTCATCCAGGTGGCATTCATCACTCTGGCCGTCGCGGCTGGACTGTACTACCTTGCAGAGCTGATTGAAGAGTA
hide sequence
RefSeq Acc Id:
XM_008763059 ⟹ XP_008761281
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 117,813,050 - 117,818,096 (-) NCBI mRatBN7.2 4 116,253,547 - 116,260,464 (-) NCBI Rnor_6.0 4 115,446,830 - 115,453,730 (-) NCBI
Sequence:
GTCCCCGGGGCGGGGACAGCACGGCAGCGGCCGCTCAGTGTCGCGGGAGCCGGACCGCGCAGGCCCGTCCCGGCGGCCCGGGGGGCGCCATGTGGTTCATGTACGTGCTGAGCTGGCTGTCGCTGTTC
hide sequence
RefSeq Acc Id:
XM_008763061 ⟹ XP_008761283
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 117,813,050 - 117,817,666 (-) NCBI mRatBN7.2 4 116,253,547 - 116,260,210 (-) NCBI Rnor_6.0 4 115,446,830 - 115,453,516 (-) NCBI
Sequence:
GCCGCTTTTTGCAGCTGGGCGCTGACGACCCCGAGTTGGTCCTACTGGACCTCCGCCGAACCTTCTGGAGGGGATGTTTGGTTCCGGAGACGCATCCTTGCTCTCGGAGCCCTGGGCTCCCCACTCTG
hide sequence
RefSeq Acc Id:
XM_017592548 ⟹ XP_017448037
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 117,813,050 - 117,818,408 (-) NCBI mRatBN7.2 4 116,253,547 - 116,260,730 (-) NCBI Rnor_6.0 4 115,446,830 - 115,454,035 (-) NCBI
Sequence:
GTATTGCAAAAGACCTCAGCCCAGGGGGAGAGTTAGGGCTGACGGCATCTAGGATTCCGAACTATGCGGCTTCCTAGAGTGTGACCTGAGATAAGCGGCTGGACTGTACTACCTTGCAGAGCTGATTG
hide sequence
RefSeq Acc Id:
XM_039107343 ⟹ XP_038963271
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 117,813,050 - 117,817,714 (-) NCBI mRatBN7.2 4 116,253,547 - 116,260,210 (-) NCBI
RefSeq Acc Id:
NP_001017537 ⟸ NM_001017537
- UniProtKB:
Q5BJW3 (UniProtKB/Swiss-Prot), A6IAP6 (UniProtKB/TrEMBL), A0A8L2QVX6 (UniProtKB/TrEMBL)
- Sequence:
MWFMYVLSWLSLFIQVAFITLAVAAGLYYLAELIEEYTVATSRIIKYMIWFSTAVLIGLYVFERFPTSMIGVGLFTNLVYFGLLQTFPFIMLTSPNFILSCGLVVVNHYLAFQFFAEEYYPFSEVLAY
hide sequence
RefSeq Acc Id:
XP_008761281 ⟸ XM_008763059
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2QVX6 (UniProtKB/TrEMBL)
- Sequence:
MWFMYVLSWLSLFIQVAFITLAVAAGLYYLAELIEEYTVATSRIIKYMIWFSTAVLIGLYVFERFPTSMIGVGLFTNLVYFGLLQTFPFIMLTSPNFILSCGLVVVNHYLAFQFFAEEYYPFSEVLAY
hide sequence
RefSeq Acc Id:
XP_008761283 ⟸ XM_008763061
- Peptide Label:
isoform X2
- Sequence:
MIWFSTAVLIGLYVFERFPTSMIGVGLFTNLVYFGLLQTFPFIMLTSPNFILSCGLVVVNHYLAFQFFAEEYYPFSEVLAYFTFCLWIIPFAFFVSLSAGENVLPSTMQPGGEEGLLKSDDVVSNYFT
hide sequence
RefSeq Acc Id:
XP_017448037 ⟸ XM_017592548
- Peptide Label:
isoform X2
- Sequence:
MIWFSTAVLIGLYVFERFPTSMIGVGLFTNLVYFGLLQTFPFIMLTSPNFILSCGLVVVNHYLA
hide sequence
Ensembl Acc Id:
ENSRNOP00000063367 ⟸ ENSRNOT00000065847
RefSeq Acc Id:
XP_038963271 ⟸ XM_039107343
- Peptide Label:
isoform X2
RGD ID: 13693188 Promoter ID: EPDNEW_R3711 Type: initiation region Name: Tex261_1 Description: testis expressed 261 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 115,453,694 - 115,453,754 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-09-24
Tex261
testis expressed 261
Tex261
testis expressed gene 261
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Tex261
testis expressed gene 261
Tex261_predicted
testis expressed gene 261 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Tex261_predicted
testis expressed gene 261 (predicted)
Symbol and Name status set to approved
70820 APPROVED
