Symbol:
Gpr158
Name:
G protein-coupled receptor 158
RGD ID:
1305841
Description:
Predicted to enable G protein-coupled glycine receptor activity and enzyme activator activity. Predicted to be involved in several processes, including positive regulation of neurotransmitter secretion; protein localization to plasma membrane; and regulation of G protein-coupled receptor signaling pathway. Predicted to be located in membrane. Predicted to be active in postsynaptic density membrane. Orthologous to human GPR158 (G protein-coupled receptor 158); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; atrazine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC291352; metabotropic glycine receptor; mGlyR; probable G-protein coupled receptor 158; similar to G protein-coupled receptor 158 isoform a
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 88,685,879 - 89,152,659 (+) NCBI GRCr8 mRatBN7.2 17 83,777,625 - 84,244,428 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 83,834,569 - 84,244,428 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 87,313,345 - 87,722,843 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 91,148,711 - 91,558,238 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 85,165,655 - 85,575,174 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 88,215,131 - 88,654,352 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 88,215,834 - 88,651,476 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 89,902,429 - 90,335,831 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 95,323,129 - 95,730,463 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 95,333,685 - 95,738,420 (+) NCBI Celera 17 84,638,349 - 84,841,527 (-) NCBI Celera Cytogenetic Map 17 q12.3 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gpr158 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1552307 6480464 1,2-Dimethylhydrazine results in decreased expression of GPR158 mRNA CTD PMID:22206623 Gpr158 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO RGD:1314117 6480464 Dihydrotestosterone results in increased expression of GPR158 mRNA CTD PMID:29581250 Gpr158 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO RGD:1314117 6480464 2,2',4,4'-tetrabromodiphenyl ether analog results in increased expression of GPR158 mRNA CTD PMID:19095052 Gpr158 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1552307 6480464 Tetrachlorodibenzodioxin affects the expression of GPR158 mRNA CTD PMID:21570461 Gpr158 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of GPR158 mRNA CTD PMID:32109520 Gpr158 Rat 4,4'-sulfonyldiphenol multiple interactions ISO RGD:1314117 6480464 [bisphenol S co-treated with Fulvestrant] results in decreased methylation of GPR158 gene CTD PMID:31601247 Gpr158 Rat 4,4'-sulfonyldiphenol affects methylation ISO RGD:1552307 6480464 bisphenol S affects the methylation of GPR158 gene CTD PMID:31683443 Gpr158 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of GPR158 mRNA CTD PMID:24780913|PMID:25825206 Gpr158 Rat aflatoxin B1 decreases methylation ISO RGD:1314117 6480464 Aflatoxin B1 results in decreased methylation of GPR158 gene; Aflatoxin B1 results in decreased methylation more ... CTD PMID:27153756|PMID:30157460 Gpr158 Rat Aflatoxin B2 alpha increases methylation ISO RGD:1314117 6480464 aflatoxin B2 results in increased methylation of GPR158 intron CTD PMID:30157460 Gpr158 Rat arsenite(3-) increases methylation ISO RGD:1314117 6480464 arsenite results in increased methylation of GPR158 promoter CTD PMID:23974009 Gpr158 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of GPR158 gene CTD PMID:28931070 Gpr158 Rat benzo[a]pyrene increases methylation ISO RGD:1314117 6480464 Benzo(a)pyrene results in increased methylation of GPR158 3' UTR CTD PMID:27901495 Gpr158 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GPR158 mRNA CTD PMID:25181051|PMID:30816183|PMID:32528016|PMID:34947998 Gpr158 Rat bisphenol A decreases expression ISO RGD:1552307 6480464 bisphenol A results in decreased expression of GPR158 mRNA CTD PMID:32156529 Gpr158 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with tributyltin] results in increased expression of GPR158 mRNA CTD PMID:31129395 Gpr158 Rat bisphenol A decreases expression ISO RGD:1314117 6480464 bisphenol A results in decreased expression of GPR158 mRNA CTD PMID:27685785 Gpr158 Rat cadmium atom multiple interactions ISO RGD:1314117 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of GPR158 more ... CTD PMID:35301059 Gpr158 Rat cadmium dichloride multiple interactions ISO RGD:1314117 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of GPR158 more ... CTD PMID:35301059 Gpr158 Rat cyclosporin A increases expression ISO RGD:1314117 6480464 Cyclosporine results in increased expression of GPR158 mRNA CTD PMID:20106945 Gpr158 Rat dorsomorphin multiple interactions ISO RGD:1314117 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Gpr158 Rat folic acid decreases expression ISO RGD:1552307 6480464 Folic Acid results in decreased expression of GPR158 mRNA CTD PMID:25629700 Gpr158 Rat folic acid decreases expression ISO RGD:1314117 6480464 Folic Acid results in decreased expression of GPR158 mRNA CTD PMID:21867686 Gpr158 Rat FR900359 increases phosphorylation ISO RGD:1314117 6480464 FR900359 results in increased phosphorylation of GPR158 protein CTD PMID:37730182 Gpr158 Rat fulvestrant multiple interactions ISO RGD:1314117 6480464 [bisphenol S co-treated with Fulvestrant] results in decreased methylation of GPR158 gene CTD PMID:31601247 Gpr158 Rat glyphosate affects methylation EXP 6480464 Glyphosate affects the methylation of GPR158 gene CTD PMID:35440735 Gpr158 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of GPR158 gene CTD PMID:35440735 Gpr158 Rat paracetamol affects expression ISO RGD:1552307 6480464 Acetaminophen affects the expression of GPR158 mRNA CTD PMID:17562736 Gpr158 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of GPR158 mRNA CTD PMID:32680482 Gpr158 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of GPR158 mRNA CTD PMID:28374803 Gpr158 Rat SB 431542 multiple interactions ISO RGD:1314117 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Gpr158 Rat sodium arsenite decreases expression ISO RGD:1552307 6480464 sodium arsenite results in decreased expression of GPR158 mRNA CTD PMID:36209798 Gpr158 Rat sodium arsenite increases expression ISO RGD:1552307 6480464 sodium arsenite results in increased expression of GPR158 mRNA CTD PMID:37682722 Gpr158 Rat sunitinib increases expression ISO RGD:1314117 6480464 Sunitinib results in increased expression of GPR158 mRNA CTD PMID:31533062 Gpr158 Rat titanium dioxide decreases methylation ISO RGD:1552307 6480464 titanium dioxide results in decreased methylation of GPR158 gene CTD PMID:35295148 Gpr158 Rat tributylstannane multiple interactions EXP 6480464 [bisphenol A co-treated with tributyltin] results in increased expression of GPR158 mRNA CTD PMID:31129395 Gpr158 Rat trichostatin A increases expression ISO RGD:1314117 6480464 trichostatin A results in increased expression of GPR158 mRNA CTD PMID:24935251 Gpr158 Rat valproic acid decreases methylation ISO RGD:1314117 6480464 Valproic Acid results in decreased methylation of GPR158 gene CTD PMID:29154799 Gpr158 Rat valproic acid affects expression ISO RGD:1314117 6480464 Valproic Acid affects the expression of GPR158 mRNA CTD PMID:25979313 Gpr158 Rat valproic acid increases expression ISO RGD:1314117 6480464 Valproic Acid results in increased expression of GPR158 mRNA CTD PMID:23179753|PMID:24383497|PMID:24935251|PMID:26272509|PMID:28001369 Gpr158 Rat valproic acid multiple interactions ISO RGD:1314117 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386
1,2-dimethylhydrazine (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) arsenite(3-) (ISO) atrazine (EXP) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) cadmium atom (ISO) cadmium dichloride (ISO) cyclosporin A (ISO) dorsomorphin (ISO) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) glyphosate (EXP) methoxychlor (EXP) paracetamol (ISO) paraquat (EXP) rotenone (EXP) SB 431542 (ISO) sodium arsenite (ISO) sunitinib (ISO) titanium dioxide (ISO) tributylstannane (EXP) trichostatin A (ISO) valproic acid (ISO)
Biological Process
brain development (IEA,ISO) cognition (IEA,ISO,ISS) G protein-coupled receptor signaling pathway (IEA,ISO,ISS) positive regulation of neurotransmitter secretion (IEA,ISO) protein localization to plasma membrane (IEA,ISO,ISS) regulation of G protein-coupled receptor signaling pathway (IEA,ISO,ISS) regulation of synapse organization (IEA,ISO,ISS) signal transduction (IEA)
Gpr158 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 88,685,879 - 89,152,659 (+) NCBI GRCr8 mRatBN7.2 17 83,777,625 - 84,244,428 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 83,834,569 - 84,244,428 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 87,313,345 - 87,722,843 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 91,148,711 - 91,558,238 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 85,165,655 - 85,575,174 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 88,215,131 - 88,654,352 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 88,215,834 - 88,651,476 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 89,902,429 - 90,335,831 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 95,323,129 - 95,730,463 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 95,333,685 - 95,738,420 (+) NCBI Celera 17 84,638,349 - 84,841,527 (-) NCBI Celera Cytogenetic Map 17 q12.3 NCBI
GPR158 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 25,175,001 - 25,602,229 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 25,174,802 - 25,602,229 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 25,463,930 - 25,891,158 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 25,504,296 - 25,931,164 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 10 25,165,702 - 25,598,388 (+) NCBI Celera Cytogenetic Map 10 p12.1 NCBI HuRef 10 25,124,846 - 25,550,757 (+) NCBI HuRef CHM1_1 10 25,464,879 - 25,891,900 (+) NCBI CHM1_1 T2T-CHM13v2.0 10 25,193,234 - 25,626,794 (+) NCBI T2T-CHM13v2.0
Gpr158 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 21,372,378 - 21,835,355 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 21,372,353 - 21,835,358 (+) Ensembl GRCm39 Ensembl GRCm38 2 21,367,567 - 21,830,544 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 21,367,542 - 21,830,547 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 21,289,194 - 21,752,171 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 21,285,321 - 21,748,298 (+) NCBI MGSCv36 mm8 Celera 2 21,246,752 - 21,710,952 (+) NCBI Celera Cytogenetic Map 2 A3 NCBI cM Map 2 14.92 NCBI
Gpr158 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955429 3,641,709 - 4,053,869 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955429 3,641,764 - 4,053,860 (-) NCBI ChiLan1.0 ChiLan1.0
GPR158 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 37,876,693 - 38,299,274 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 37,881,597 - 38,304,599 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 25,352,131 - 25,777,652 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 25,721,768 - 26,143,954 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 25,722,127 - 26,140,997 (+) Ensembl panpan1.1 panPan2
GPR158 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 7,969,781 - 8,379,657 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 7,971,800 - 8,378,198 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 6,664,668 - 7,073,497 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 6,168,494 - 6,578,286 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 6,168,494 - 6,578,139 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 5,538,054 - 5,948,261 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 5,616,670 - 6,026,418 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 5,782,879 - 6,192,914 (-) NCBI UU_Cfam_GSD_1.0
Gpr158 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 24,670,867 - 25,061,002 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936484 836,700 - 1,226,162 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936484 835,886 - 1,224,450 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GPR158 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 10 49,862,312 - 50,202,453 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 10 49,862,312 - 50,202,748 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 10 55,286,186 - 55,471,492 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GPR158
Gpr158
.
Predicted Target Of
Count of predictions: 331 Count of miRNA genes: 197 Interacting mature miRNAs: 236 Transcripts: ENSRNOT00000034098 Prediction methods: Miranda, Pita Result types: miRGate_prediction
8694181 Bw151 Body weight QTL 151 4.36 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 17 48560935 86533673 Rat 1358295 Aocep1 Aortic cell protein QTL 1 6.1 7e-07 thoracic aorta cellular protein amount (VT:0010598) aortic cell percentage 17 40990005 85990005 Rat 7411575 Bw140 Body weight QTL 140 30.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 17 48560935 86533673 Rat 2317045 Aia11 Adjuvant induced arthritis QTL 11 4.06 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 17 60781426 86533673 Rat 7411577 Bw141 Body weight QTL 141 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 17 62619516 86533673 Rat 4889894 Eae33 Experimental allergic encephalomyelitis QTL 33 5.2 0.0001 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 17 50909099 86022412 Rat 2317038 Ginf3 Gastrointestinal inflammation QTL 3 2.89 0.005 liver integrity trait (VT:0010547) liver granuloma severity score (CMO:0002157) 17 49920154 86533673 Rat 2303580 Gluco49 Glucose level QTL 49 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 17 50040271 86533673 Rat
D17Got107
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 84,150,477 - 84,150,623 (+) MAPPER mRatBN7.2 Rnor_6.0 17 88,559,593 - 88,559,738 NCBI Rnor6.0 Rnor_5.0 17 90,242,677 - 90,242,822 UniSTS Rnor5.0 Celera 17 84,731,947 - 84,732,092 UniSTS RH 3.4 Map 17 868.8 RGD RH 3.4 Map 17 868.8 UniSTS Cytogenetic Map 17 q12.3 UniSTS
BE119491
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 83,922,999 - 83,923,164 (+) MAPPER mRatBN7.2 Rnor_6.0 17 88,336,752 - 88,336,916 NCBI Rnor6.0 Rnor_5.0 17 90,022,350 - 90,022,514 UniSTS Rnor5.0 RGSC_v3.4 17 95,414,071 - 95,414,235 UniSTS RGSC3.4 Celera 17 83,176,898 - 83,177,062 UniSTS RH 3.4 Map 17 876.4 UniSTS Cytogenetic Map 17 q12.3 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
8
6
22
113
75
74
49
11
49
6
134
53
93
18
56
25
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000034098 ⟹ ENSRNOP00000038884
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 83,834,569 - 84,244,428 (+) Ensembl Rnor_6.0 Ensembl 17 88,215,834 - 88,651,476 (+) Ensembl
RefSeq Acc Id:
NM_001170326 ⟹ NP_001163797
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 88,742,823 - 89,152,658 (+) NCBI mRatBN7.2 17 83,834,569 - 84,244,428 (+) NCBI Rnor_6.0 17 88,215,131 - 88,654,352 (+) NCBI Rnor_5.0 17 89,902,429 - 90,335,831 (+) NCBI RGSC_v3.4 17 95,323,129 - 95,730,463 (+) RGD Celera 17 84,638,349 - 84,841,527 (-) RGD
Sequence:
GCCGCCCTAGAAGGGTTTGGTTGCGGCCAAGCTGTCTCTTTAAACTGGTTTCATCTGAGAGCAGGGAGAGGCAGCGGTGCGGTTTGTGGTAAGGGCTCCAGTTAACCAGCTGCCTGGCAGTCTGGACT
hide sequence
RefSeq Acc Id:
XM_039095563 ⟹ XP_038951491
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 88,685,879 - 89,152,659 (+) NCBI mRatBN7.2 17 83,777,625 - 84,244,422 (+) NCBI
RefSeq Acc Id:
XM_039095564 ⟹ XP_038951492
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 88,685,900 - 89,152,659 (+) NCBI mRatBN7.2 17 83,777,644 - 84,244,422 (+) NCBI
RefSeq Acc Id:
NP_001163797 ⟸ NM_001170326
- Peptide Label:
precursor
- UniProtKB:
D4A6L0 (UniProtKB/Swiss-Prot)
- Sequence:
MGAMAYSLLLCLLLAHLGLGEVGASLDPSERPDSSRERTSRGKQHGQQLPRASAPDPSIPWSRSTDGTILAQKLAEEVPMDVASYLYTGDFHQLKRANCSGRYELAGLPGKSPSLASSHPSLHGALDT
hide sequence
Ensembl Acc Id:
ENSRNOP00000038884 ⟸ ENSRNOT00000034098
RefSeq Acc Id:
XP_038951491 ⟸ XM_039095563
- Peptide Label:
isoform X1
- UniProtKB:
D4A6L0 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038951492 ⟸ XM_039095564
- Peptide Label:
isoform X1
- UniProtKB:
D4A6L0 (UniProtKB/Swiss-Prot)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-05-24
Gpr158
G protein-coupled receptor 158
LOC686523
similar to G protein-coupled receptor 158 isoform a
Data merged from RGD:1596374
1643240 APPROVED
2013-05-24
Gpr158
G protein-coupled receptor 158
LOC678897
similar to G protein-coupled receptor 158 isoform a
Data merged from RGD:1595524
1643240 APPROVED
2008-04-30
Gpr158
G protein-coupled receptor 158
Gpr158_predicted
G protein-coupled receptor 158 (predicted)
'predicted' is removed
2292626 APPROVED
2006-11-20
LOC686523
similar to G protein-coupled receptor 158 isoform a
Symbol and Name status set to provisional
70820 PROVISIONAL
2006-11-20
LOC678897
similar to G protein-coupled receptor 158 isoform a
Symbol and Name status set to provisional
70820 PROVISIONAL
2005-01-12
Gpr158_predicted
G protein-coupled receptor 158 (predicted)
Symbol and Name status set to approved
70820 APPROVED
