Symbol:
Fbxl3
Name:
F-box and leucine-rich repeat protein 3
RGD ID:
1305660
Description:
Predicted to contribute to ubiquitin-protein transferase activity. Predicted to be involved in several processes, including SCF-dependent proteasomal ubiquitin-dependent protein catabolic process; entrainment of circadian clock by photoperiod; and protein destabilization. Predicted to be located in nuclear body. Predicted to be part of SCF ubiquitin ligase complex. Predicted to be active in cytosol and nucleus. Orthologous to human FBXL3 (F-box and leucine rich repeat protein 3); INTERACTS WITH 2,4-dinitrotoluene; 2,6-dinitrotoluene; 4,4'-sulfonyldiphenol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
F-box and leucine-rich repeat protein 3a; F-box/LRR-repeat protein 3; Fbxl3a; LOC306129
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 86,321,504 - 86,341,387 (-) NCBI GRCr8 mRatBN7.2 15 79,906,795 - 79,926,678 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 79,906,795 - 79,927,867 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 83,885,188 - 83,905,079 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 85,008,227 - 85,028,119 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 81,935,852 - 81,955,744 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 93,647,307 - 93,667,395 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 93,647,310 - 93,667,395 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 97,135,100 - 97,155,065 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 87,093,141 - 87,113,003 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 87,110,759 - 87,128,783 (-) NCBI Celera 15 79,046,955 - 79,066,741 (-) NCBI Celera Cytogenetic Map 15 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Fbxl3 Rat 1,2-dimethylhydrazine decreases expression ISO Fbxl3 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of FBXL3 mRNA CTD PMID:22206623 Fbxl3 Rat 1,2-dimethylhydrazine multiple interactions ISO Fbxl3 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of FBXL3 mRNA CTD PMID:22206623 Fbxl3 Rat 17alpha-ethynylestradiol affects expression ISO Fbxl3 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of FBXL3 mRNA CTD PMID:17555576 Fbxl3 Rat 17beta-estradiol decreases expression ISO FBXL3 (Homo sapiens) 6480464 Estradiol results in decreased expression of FBXL3 mRNA CTD PMID:31614463 Fbxl3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Fbxl3 (Mus musculus) 6480464 AHR protein inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of FBXL3 mRNA] CTD PMID:15034205 Fbxl3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Fbxl3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of FBXL3 mRNA CTD PMID:15034205 Fbxl3 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of FBXL3 mRNA CTD PMID:21346803 Fbxl3 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of FBXL3 mRNA CTD PMID:21346803 Fbxl3 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO FBXL3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of FBXL3 mRNA CTD PMID:28628672 Fbxl3 Rat 4,4'-sulfonyldiphenol decreases expression ISO Fbxl3 (Mus musculus) 6480464 bisphenol S results in decreased expression of FBXL3 mRNA CTD PMID:39298647 Fbxl3 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of FBXL3 mRNA CTD PMID:36041667 Fbxl3 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of FBXL3 mRNA CTD PMID:36843608 Fbxl3 Rat acetylsalicylic acid increases expression ISO FBXL3 (Homo sapiens) 6480464 Aspirin results in increased expression of FBXL3 mRNA CTD PMID:15928584 Fbxl3 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of FBXL3 mRNA CTD PMID:38685447 Fbxl3 Rat aristolochic acid A decreases expression ISO FBXL3 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of FBXL3 mRNA CTD PMID:33212167 Fbxl3 Rat benzo[a]pyrene decreases expression ISO Fbxl3 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of FBXL3 mRNA CTD PMID:15034205 Fbxl3 Rat benzo[a]pyrene multiple interactions ISO Fbxl3 (Mus musculus) 6480464 AHR protein promotes the reaction [Benzo(a)pyrene results in decreased expression of FBXL3 mRNA] CTD PMID:15034205 Fbxl3 Rat benzo[a]pyrene diol epoxide I decreases expression ISO FBXL3 (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 Fbxl3 Rat bisphenol A multiple interactions ISO FBXL3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of FBXL3 mRNA CTD PMID:28628672 Fbxl3 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of FBXL3 mRNA CTD PMID:36041667 Fbxl3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of FBXL3 mRNA CTD PMID:33296240 Fbxl3 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of FBXL3 mRNA CTD PMID:36041667 Fbxl3 Rat cadmium dichloride decreases expression ISO FBXL3 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of FBXL3 mRNA CTD PMID:38568856 Fbxl3 Rat chlordecone decreases expression ISO Fbxl3 (Mus musculus) 6480464 Chlordecone results in decreased expression of FBXL3 mRNA CTD PMID:29980752 Fbxl3 Rat chlorpyrifos decreases expression ISO Fbxl3 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of FBXL3 mRNA CTD PMID:37019170 Fbxl3 Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of FBXL3 mRNA CTD PMID:17898221 Fbxl3 Rat crocidolite asbestos decreases expression ISO Fbxl3 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of FBXL3 mRNA CTD PMID:29279043 Fbxl3 Rat dexamethasone multiple interactions ISO FBXL3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of FBXL3 mRNA CTD PMID:28628672 Fbxl3 Rat dibutyl phthalate increases expression ISO Fbxl3 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of FBXL3 mRNA CTD PMID:21266533 Fbxl3 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of FBXL3 mRNA CTD PMID:21266533 Fbxl3 Rat dicrotophos decreases expression ISO FBXL3 (Homo sapiens) 6480464 dicrotophos results in decreased expression of FBXL3 mRNA CTD PMID:28302478 Fbxl3 Rat doxorubicin increases expression ISO Fbxl3 (Mus musculus) 6480464 Doxorubicin results in increased expression of FBXL3 mRNA CTD PMID:25896364 Fbxl3 Rat entinostat decreases expression ISO FBXL3 (Homo sapiens) 6480464 entinostat results in decreased expression of FBXL3 mRNA CTD PMID:27188386 Fbxl3 Rat epoxiconazole increases expression ISO Fbxl3 (Mus musculus) 6480464 epoxiconazole results in increased expression of FBXL3 mRNA CTD PMID:35436446 Fbxl3 Rat ethanol affects splicing ISO Fbxl3 (Mus musculus) 6480464 Ethanol affects the splicing of FBXL3 mRNA CTD PMID:30319688 Fbxl3 Rat folic acid multiple interactions ISO Fbxl3 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of FBXL3 mRNA CTD PMID:22206623 Fbxl3 Rat folic acid decreases expression ISO Fbxl3 (Mus musculus) 6480464 Folic Acid results in decreased expression of FBXL3 mRNA CTD PMID:25629700 Fbxl3 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of FBXL3 mRNA CTD PMID:22061828 Fbxl3 Rat hypochlorous acid increases expression ISO Fbxl3 (Mus musculus) 6480464 Hypochlorous Acid results in increased expression of FBXL3 mRNA CTD PMID:19376150 Fbxl3 Rat indometacin multiple interactions ISO FBXL3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of FBXL3 mRNA CTD PMID:28628672 Fbxl3 Rat lead diacetate decreases expression ISO Fbxl3 (Mus musculus) 6480464 lead acetate results in decreased expression of FBXL3 mRNA CTD PMID:22609695 Fbxl3 Rat phenobarbital affects expression ISO Fbxl3 (Mus musculus) 6480464 Phenobarbital affects the expression of FBXL3 mRNA CTD PMID:23091169 Fbxl3 Rat phenytoin increases expression EXP 6480464 Phenytoin results in increased expression of FBXL3 mRNA CTD PMID:20345932 Fbxl3 Rat pirinixic acid increases expression ISO Fbxl3 (Mus musculus) 6480464 pirinixic acid results in increased expression of FBXL3 mRNA CTD PMID:17426115 Fbxl3 Rat resveratrol multiple interactions ISO FBXL3 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of FBXL3 mRNA CTD PMID:23557933 Fbxl3 Rat sodium arsenate decreases expression ISO Fbxl3 (Mus musculus) 6480464 sodium arsenate results in decreased expression of FBXL3 mRNA CTD PMID:21795629 Fbxl3 Rat sodium arsenite decreases expression ISO FBXL3 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of FBXL3 mRNA CTD PMID:34032870 Fbxl3 Rat Soman increases expression EXP 6480464 Soman results in increased expression of FBXL3 mRNA CTD PMID:19281266 Fbxl3 Rat sunitinib increases expression ISO FBXL3 (Homo sapiens) 6480464 Sunitinib results in increased expression of FBXL3 mRNA CTD PMID:31533062 Fbxl3 Rat tamoxifen affects expression ISO Fbxl3 (Mus musculus) 6480464 Tamoxifen affects the expression of FBXL3 mRNA CTD PMID:17555576 Fbxl3 Rat tetrachloromethane decreases expression ISO Fbxl3 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of FBXL3 mRNA CTD PMID:17484886 Fbxl3 Rat titanium dioxide decreases methylation ISO Fbxl3 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of FBXL3 promoter CTD PMID:35295148 Fbxl3 Rat trichostatin A increases expression ISO FBXL3 (Homo sapiens) 6480464 trichostatin A results in increased expression of FBXL3 mRNA CTD PMID:24935251 Fbxl3 Rat triptonide decreases expression ISO Fbxl3 (Mus musculus) 6480464 triptonide results in decreased expression of FBXL3 mRNA CTD PMID:33045310 Fbxl3 Rat tungsten increases expression ISO Fbxl3 (Mus musculus) 6480464 Tungsten results in increased expression of FBXL3 mRNA CTD PMID:30912803 Fbxl3 Rat urethane increases expression ISO FBXL3 (Homo sapiens) 6480464 Urethane results in increased expression of FBXL3 mRNA CTD PMID:28818685 Fbxl3 Rat valproic acid decreases expression ISO FBXL3 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of FBXL3 mRNA CTD PMID:23179753 more ...
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 6-propyl-2-thiouracil (EXP) acetylsalicylic acid (ISO) amitrole (EXP) aristolochic acid A (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) cadmium dichloride (ISO) chlordecone (ISO) chlorpyrifos (ISO) cocaine (EXP) crocidolite asbestos (ISO) dexamethasone (ISO) dibutyl phthalate (EXP,ISO) dicrotophos (ISO) doxorubicin (ISO) entinostat (ISO) epoxiconazole (ISO) ethanol (ISO) folic acid (ISO) gentamycin (EXP) hypochlorous acid (ISO) indometacin (ISO) lead diacetate (ISO) phenobarbital (ISO) phenytoin (EXP) pirinixic acid (ISO) resveratrol (ISO) sodium arsenate (ISO) sodium arsenite (ISO) Soman (EXP) sunitinib (ISO) tamoxifen (ISO) tetrachloromethane (ISO) titanium dioxide (ISO) trichostatin A (ISO) triptonide (ISO) tungsten (ISO) urethane (ISO) valproic acid (ISO)
Fbxl3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 86,321,504 - 86,341,387 (-) NCBI GRCr8 mRatBN7.2 15 79,906,795 - 79,926,678 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 79,906,795 - 79,927,867 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 83,885,188 - 83,905,079 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 85,008,227 - 85,028,119 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 81,935,852 - 81,955,744 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 93,647,307 - 93,667,395 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 93,647,310 - 93,667,395 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 97,135,100 - 97,155,065 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 87,093,141 - 87,113,003 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 87,110,759 - 87,128,783 (-) NCBI Celera 15 79,046,955 - 79,066,741 (-) NCBI Celera Cytogenetic Map 15 q21 NCBI
FBXL3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 13 77,005,260 - 77,027,159 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 13 76,992,598 - 77,027,195 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 13 77,579,395 - 77,601,294 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 13 76,477,397 - 76,499,258 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 13 76,477,396 - 76,499,258 NCBI Celera 13 58,477,376 - 58,499,318 (-) NCBI Celera Cytogenetic Map 13 q22.3 NCBI HuRef 13 58,277,088 - 58,299,043 (-) NCBI HuRef CHM1_1 13 77,547,295 - 77,569,223 (-) NCBI CHM1_1 T2T-CHM13v2.0 13 76,222,648 - 76,250,801 (-) NCBI T2T-CHM13v2.0
Fbxl3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 103,318,470 - 103,337,016 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 103,317,675 - 103,337,002 (-) Ensembl GRCm39 Ensembl GRCm38 14 103,080,239 - 103,099,566 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 103,080,239 - 103,099,566 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 103,479,456 - 103,498,726 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 101,967,535 - 101,986,017 (-) NCBI MGSCv36 mm8 Celera 14 101,708,112 - 101,723,414 (-) NCBI Celera Cytogenetic Map 14 E2.3 NCBI cM Map 14 51.73 NCBI
Fbxl3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955404 30,215,108 - 30,229,798 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955404 30,215,140 - 30,229,798 (+) NCBI ChiLan1.0 ChiLan1.0
FBXL3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 14 78,574,434 - 78,596,390 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 13 77,170,580 - 77,192,331 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 13 58,219,260 - 58,244,780 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 13 77,266,496 - 77,283,651 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 13 77,266,496 - 77,283,651 (-) Ensembl panpan1.1 panPan2
FBXL3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 22 30,579,598 - 30,598,879 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 22 30,581,474 - 30,598,886 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 22 30,440,696 - 30,459,977 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 22 30,891,689 - 30,910,990 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 22 30,891,692 - 30,911,121 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 22 30,559,157 - 30,578,437 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 22 30,597,466 - 30,616,743 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 22 30,666,969 - 30,686,249 (-) NCBI UU_Cfam_GSD_1.0
Fbxl3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 128,841,836 - 128,863,274 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936511 4,258,548 - 4,283,285 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936511 4,259,066 - 4,280,501 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
FBXL3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 11 49,131,665 - 49,151,009 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 11 49,131,663 - 49,151,380 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 11 53,769,579 - 53,788,895 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
FBXL3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 3 56,089,147 - 56,111,472 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 3 56,088,938 - 56,105,977 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666046 12,297,829 - 12,320,027 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Fbxl3
.
Predicted Target Of
Count of predictions: 700 Count of miRNA genes: 302 Interacting mature miRNAs: 396 Transcripts: ENSRNOT00000057789 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
731177 Uae26 Urinary albumin excretion QTL 26 2.4 0.025 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 15 67588667 101769107 Rat 1300144 Rf23 Renal function QTL 23 3.61 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 15 40631268 98288169 Rat 1576315 Schws6 Schwannoma susceptibility QTL 6 0.0069 nervous system integrity trait (VT:0010566) post-insult time of death (CMO:0002005) 15 53806152 98806152 Rat 1549844 Bss7 Bone structure and strength QTL 7 6.4 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 15 75788062 101769107 Rat 61477 Aia4 Adjuvant induced arthritis QTL 4 3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 15 55596089 91365858 Rat 2300326 Plaw1 Placental weight QTL 1 15 0.005 placenta mass (VT:0004257) placenta wet weight (CMO:0002088) 15 68327165 100062518 Rat 70182 BpQTLcluster12 Blood pressure QTL cluster 12 3.53 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 15 73690657 95018120 Rat 152025253 Hrtrt24 Heart rate QTL 24 3.82 heart pumping trait (VT:2000009) 15 27885774 86257085 Rat 70155 Gcs1 Gastric cancer susceptibility QTL1 3.8 stomach morphology trait (VT:0000470) stomach tumor susceptibility score (CMO:0002043) 15 76306099 101769107 Rat 1582227 Gluco30 Glucose level QTL 30 3.6 0.0003 blood glucose amount (VT:0000188) absolute change in blood glucose level area under curve (CMO:0002034) 15 28030665 82262678 Rat 1581555 Eae19 Experimental allergic encephalomyelitis QTL 19 4.7 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 15 76306099 90088744 Rat 1582228 Epfw3 Epididymal fat weight QTL 3 4.1 0.0002 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 15 28030665 82262678 Rat 1578646 Bmd18 Bone mineral density QTL 18 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 15 22806240 98288169 Rat 631655 Bp126 Blood pressure QTL 126 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 15 58156477 101769107 Rat 1578647 Bmd17 Bone mineral density QTL 17 4 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 15 22806240 98288169 Rat 61424 Scl1 Serum cholesterol level QTL 1 7.7 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 15 16725528 80672115 Rat 631516 Gluco31 Glucose level QTL 31 7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 15 55596089 95018120 Rat 1331724 Bp223 Blood pressure QTL 223 3.53715 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 15 73690518 95018228 Rat 1641889 Colcr6 Colorectal carcinoma resistance QTL 6 2.9 0.0126 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 15 73690518 99794247 Rat 1582242 Gluco28 Glucose level QTL 28 3.3 0.0008 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 15 28030665 82262678 Rat 1578660 Bss19 Bone structure and strength QTL 19 4.3 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 15 22806240 98288169 Rat 1582244 Bw79 Body weight QTL 79 4 0.0002 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 15 28030665 82262678 Rat 2317055 Aia10 Adjuvant induced arthritis QTL 10 3.41 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 15 75788062 101769107 Rat 1582214 Stl21 Serum triglyceride level QTL 21 3.1 0.022 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 15 28030665 82262678 Rat
RH131875
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 79,908,673 - 79,908,876 (+) MAPPER mRatBN7.2 Rnor_6.0 15 93,649,382 - 93,649,584 NCBI Rnor6.0 Rnor_5.0 15 97,137,175 - 97,137,377 UniSTS Rnor5.0 RGSC_v3.4 15 87,095,020 - 87,095,222 UniSTS RGSC3.4 Celera 15 79,048,834 - 79,049,036 UniSTS RH 3.4 Map 15 536.2 UniSTS Cytogenetic Map 15 q22 UniSTS
RH134429
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 79,907,054 - 79,907,271 (+) MAPPER mRatBN7.2 Rnor_6.0 15 93,647,763 - 93,647,979 NCBI Rnor6.0 Rnor_5.0 15 97,135,556 - 97,135,772 UniSTS Rnor5.0 RGSC_v3.4 15 87,093,401 - 87,093,617 UniSTS RGSC3.4 Celera 15 79,047,215 - 79,047,431 UniSTS RH 3.4 Map 15 547.6 UniSTS Cytogenetic Map 15 q22 UniSTS
BE109190
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 79,927,400 - 79,927,564 (+) MAPPER mRatBN7.2 Rnor_6.0 15 93,668,118 - 93,668,281 NCBI Rnor6.0 Rnor_5.0 15 97,155,788 - 97,155,951 UniSTS Rnor5.0 RGSC_v3.4 15 87,113,726 - 87,113,889 UniSTS RGSC3.4 Celera 15 79,067,464 - 79,067,627 UniSTS RH 3.4 Map 15 498.71 UniSTS Cytogenetic Map 15 q22 UniSTS
RH140351
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 79,927,731 - 79,927,888 (+) MAPPER mRatBN7.2 Rnor_6.0 15 93,668,449 - 93,668,605 NCBI Rnor6.0 Rnor_5.0 15 97,156,119 - 97,156,275 UniSTS Rnor5.0 RGSC_v3.4 15 87,114,057 - 87,114,213 UniSTS RGSC3.4 Celera 15 79,067,795 - 79,067,951 UniSTS RH 3.4 Map 15 547.4 UniSTS Cytogenetic Map 15 q22 UniSTS
AI178492
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 79,906,487 - 79,906,674 (+) MAPPER mRatBN7.2 Rnor_6.0 15 93,647,196 - 93,647,382 NCBI Rnor6.0 Rnor_5.0 15 97,134,989 - 97,135,175 UniSTS Rnor5.0 RGSC_v3.4 15 87,092,834 - 87,093,020 UniSTS RGSC3.4 Celera 15 79,046,648 - 79,046,834 UniSTS RH 3.4 Map 15 499.01 UniSTS Cytogenetic Map 15 q22 UniSTS
AI009239
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 79,909,524 - 79,909,744 (+) MAPPER mRatBN7.2 Rnor_6.0 15 93,650,233 - 93,650,452 NCBI Rnor6.0 Rnor_5.0 15 97,138,026 - 97,138,245 UniSTS Rnor5.0 RGSC_v3.4 15 87,095,871 - 87,096,090 UniSTS RGSC3.4 Celera 15 79,049,685 - 79,049,904 UniSTS RH 3.4 Map 15 520.19 UniSTS Cytogenetic Map 15 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000089876 ⟹ ENSRNOP00000071266
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 79,906,795 - 79,927,867 (-) Ensembl Rnor_6.0 Ensembl 15 93,647,503 - 93,667,395 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000093184 ⟹ ENSRNOP00000076303
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 15 93,656,743 - 93,667,116 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000093568
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 15 93,649,686 - 93,656,985 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000093571 ⟹ ENSRNOP00000076079
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 15 93,647,310 - 93,667,355 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000093603 ⟹ ENSRNOP00000076144
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 15 93,649,250 - 93,666,808 (-) Ensembl
RefSeq Acc Id:
NM_001100568 ⟹ NP_001094038
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 86,321,504 - 86,341,387 (-) NCBI mRatBN7.2 15 79,906,795 - 79,926,678 (-) NCBI Rnor_6.0 15 93,647,503 - 93,667,395 (-) NCBI Rnor_5.0 15 97,135,100 - 97,155,065 (-) NCBI RGSC_v3.4 15 87,093,141 - 87,113,003 (-) RGD Celera 15 79,046,955 - 79,066,741 (-) RGD
Sequence:
GAGGCTCGGGGCTCGCTGCTGTTGGCTGCTGTTGGCCGCTGCTCGCCGAGGGCGTCTCGGGCGGCGACGAGGAGGTGCCGGGGCGAAGGACGCAGACTGCGCGGGACAGAGAAAGGAAGCTTTCCGCC
hide sequence
RefSeq Acc Id:
XM_006252442 ⟹ XP_006252504
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 86,321,505 - 86,340,800 (-) NCBI mRatBN7.2 15 79,906,795 - 79,926,128 (-) NCBI Rnor_6.0 15 93,647,307 - 93,667,074 (-) NCBI Rnor_5.0 15 97,135,100 - 97,155,065 (-) NCBI
Sequence:
CAGACGGTACGGCGGAGGTTCGGGGCCGCAGCCCGGAGTCCGGCGGGGAGGTCGGCGGCGGCCGGGGGCGCGCGCGGGAACGCCCCGCCTGGACCTCAGTACTTGTCAACAAGGCGTGGCGCGCGCTC
hide sequence
RefSeq Acc Id:
XM_039093401 ⟹ XP_038949329
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 86,321,505 - 86,341,193 (-) NCBI mRatBN7.2 15 79,906,795 - 79,926,482 (-) NCBI
RefSeq Acc Id:
XM_039093402 ⟹ XP_038949330
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 86,321,505 - 86,341,107 (-) NCBI mRatBN7.2 15 79,906,795 - 79,926,482 (-) NCBI
RefSeq Acc Id:
NP_001094038 ⟸ NM_001100568
- UniProtKB:
G3V9P4 (UniProtKB/TrEMBL), A6HU89 (UniProtKB/TrEMBL)
- Sequence:
MKRGGRDSDQDSPEEGTAEKPKKPRTTHECSQPCDWGNLLQDIVLHVFKYLPLLDRAHASQVCRNWNQVFHMPDLWRCFEFELNQPATSYLKATHPELIKQIIKRHSNHLQYVSFKVDSSKESAEAAC
hide sequence
RefSeq Acc Id:
XP_006252504 ⟸ XM_006252442
- Peptide Label:
isoform X1
- UniProtKB:
G3V9P4 (UniProtKB/TrEMBL), A6HU89 (UniProtKB/TrEMBL)
- Sequence:
MKRGGRDSDQDSPEEGTAEKPKKPRTTHECSQPCDWGNLLQDIVLHVFKYLPLLDRAHASQVCR
hide sequence
Ensembl Acc Id:
ENSRNOP00000071266 ⟸ ENSRNOT00000089876
Ensembl Acc Id:
ENSRNOP00000076144 ⟸ ENSRNOT00000093603
Ensembl Acc Id:
ENSRNOP00000076079 ⟸ ENSRNOT00000093571
Ensembl Acc Id:
ENSRNOP00000076303 ⟸ ENSRNOT00000093184
RefSeq Acc Id:
XP_038949330 ⟸ XM_039093402
- Peptide Label:
isoform X2
- UniProtKB:
G3V9P4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038949329 ⟸ XM_039093401
- Peptide Label:
isoform X1
- UniProtKB:
A6HU89 (UniProtKB/TrEMBL), G3V9P4 (UniProtKB/TrEMBL)
RGD ID: 13699868 Promoter ID: EPDNEW_R10392 Type: multiple initiation site Name: Fbxl3_1 Description: F-box and leucine-rich repeat protein 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 15 93,667,406 - 93,667,466 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-03-30
Fbxl3
F-box and leucine-rich repeat protein 3
Fbxl3a
F-box and leucine-rich repeat protein 3a
Symbol and Name updated
1299863 APPROVED
2005-12-06
Fbxl3a
F-box and leucine-rich repeat protein 3a
Fbxl3a_predicted
F-box and leucine-rich repeat protein 3a (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Fbxl3a_predicted
F-box and leucine-rich repeat protein 3a (predicted)
Symbol and Name status set to approved
70820 APPROVED
