Advanced Search (OLGA)

Gene: Ddx27 (DEAD-box helicase 27) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Ddx27

Name:

DEAD-box helicase 27

RGD ID:

1305634

Description:

Predicted to enable several functions, including ATP binding activity; RNA helicase activity; and nucleic acid binding activity. Predicted to be involved in rRNA processing. Predicted to be located in chromosome. Predicted to be active in nucleolus. Orthologous to human DDX27 (DEAD-box helicase 27); INTERACTS WITH (+)-schisandrin B; 17alpha-ethynylestradiol; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

DEAD (Asp-Glu-Ala-Asp) box polypeptide 27; LOC362274; probable ATP-dependent RNA helicase DDX27; similar to Probable ATP-dependent RNA helicase DDX27 (DEAD box protein 27)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DDX27 (DEAD-box helicase 27)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Ddx27 (DEAD box helicase 27)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ddx27 (DEAD-box helicase 27)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DDX27 (DEAD-box helicase 27)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DDX27 (DEAD-box helicase 27)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ddx27 (DEAD-box helicase 27)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DDX27 (DEAD-box helicase 27)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DDX27 (DEAD-box helicase 27)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ddx27 (DEAD-box helicase 27)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	DDX27 (DEAD-box helicase 27)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ddx27 (DEAD box helicase 27)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ddx27 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 27)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	DRS1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Rs1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ddx-27	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ddx27	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	176,163,220 - 176,182,418 (+)	NCBI		GRCr8
mRatBN7.2	3	155,744,182 - 155,763,380 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	155,744,150 - 155,763,372 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	159,545,494 - 159,564,670 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	168,044,467 - 168,063,643 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	165,786,175 - 165,805,351 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	163,767,236 - 163,786,408 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	163,767,173 - 163,786,445 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	169,927,524 - 169,946,728 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	158,165,670 - 158,185,490 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	158,071,719 - 158,091,133 (+)	NCBI
Celera	3	154,325,693 - 154,370,898 (+)	NCBI		Celera
Cytogenetic Map	3	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ddx27	Rat	developmental and epileptic encephalopathy 26		ISO	DDX27 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Developmental and epileptic encephalopathy and 26	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ddx27	Rat	(+)-schisandrin B	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of DDX27 mRNA]	CTD	PMID:31150632
Ddx27	Rat	17alpha-ethynylestradiol	increases expression	ISO	Ddx27 (Mus musculus)	6480464	Ethinyl Estradiol results in increased expression of DDX27 mRNA	CTD	PMID:17942748
Ddx27	Rat	17alpha-ethynylestradiol	decreases expression	EXP		6480464	Ethinyl Estradiol results in decreased expression of DDX27 mRNA	CTD	PMID:29097150
Ddx27	Rat	17beta-estradiol	increases expression	ISO	DDX27 (Homo sapiens)	6480464	Estradiol results in increased expression of DDX27 mRNA	CTD	PMID:19698761
Ddx27	Rat	17beta-estradiol	multiple interactions	ISO	DDX27 (Homo sapiens)	6480464	[Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in increased expression of DDX27 mRNA	CTD	PMID:20823114
Ddx27	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Ddx27 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of DDX27 mRNA	CTD	PMID:21570461
Ddx27	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	Ddx27 (Mus musculus)	6480464	bisphenol S results in increased expression of DDX27 mRNA	CTD	PMID:39298647
Ddx27	Rat	afimoxifene	decreases expression	ISO	DDX27 (Homo sapiens)	6480464	afimoxifene results in decreased expression of DDX27 mRNA	CTD	PMID:19698761
Ddx27	Rat	Aroclor 1254	decreases expression	ISO	Ddx27 (Mus musculus)	6480464	Chlorodiphenyl (54% Chlorine) results in decreased expression of DDX27 mRNA	CTD	PMID:23650126
Ddx27	Rat	arsane	affects methylation	ISO	DDX27 (Homo sapiens)	6480464	Arsenic affects the methylation of DDX27 gene	CTD	PMID:25304211
Ddx27	Rat	arsenic atom	affects methylation	ISO	DDX27 (Homo sapiens)	6480464	Arsenic affects the methylation of DDX27 gene	CTD	PMID:25304211
Ddx27	Rat	atrazine	decreases expression	ISO	DDX27 (Homo sapiens)	6480464	Atrazine results in decreased expression of DDX27 mRNA	CTD	PMID:22378314
Ddx27	Rat	benzo[a]pyrene	decreases expression	ISO	DDX27 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased expression of DDX27 protein	CTD	PMID:33278487
Ddx27	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of DDX27 mRNA	CTD	PMID:25181051
Ddx27	Rat	bisphenol A	decreases expression	ISO	DDX27 (Homo sapiens)	6480464	bisphenol A results in decreased expression of DDX27 protein	CTD	PMID:37567409
Ddx27	Rat	bisphenol A	decreases expression	ISO	Ddx27 (Mus musculus)	6480464	bisphenol A results in decreased expression of DDX27 mRNA	CTD	PMID:33221593
Ddx27	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of DDX27 mRNA	CTD	PMID:30816183 more ...
Ddx27	Rat	bisphenol A	affects expression	ISO	DDX27 (Homo sapiens)	6480464	bisphenol A affects the expression of DDX27 mRNA	CTD	PMID:30903817
Ddx27	Rat	bucladesine	multiple interactions	ISO	DDX27 (Homo sapiens)	6480464	[Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in increased expression of DDX27 mRNA	CTD	PMID:20823114
Ddx27	Rat	casticin	decreases expression	ISO	Ddx27 (Mus musculus)	6480464	casticin results in decreased expression of DDX27 mRNA	CTD	PMID:28444820
Ddx27	Rat	chlorpyrifos	decreases expression	ISO	Ddx27 (Mus musculus)	6480464	Chlorpyrifos results in decreased expression of DDX27 mRNA	CTD	PMID:37019170
Ddx27	Rat	chromium(6+)	affects expression	ISO	Ddx27 (Mus musculus)	6480464	chromium hexavalent ion affects the expression of DDX27 mRNA	CTD	PMID:28472532
Ddx27	Rat	cyclosporin A	increases expression	ISO	DDX27 (Homo sapiens)	6480464	Cyclosporine results in increased expression of DDX27 mRNA	CTD	PMID:20106945 and PMID:25562108
Ddx27	Rat	Dibutyl phosphate	affects expression	ISO	DDX27 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of DDX27 mRNA	CTD	PMID:37042841
Ddx27	Rat	dibutyl phthalate	decreases expression	ISO	Ddx27 (Mus musculus)	6480464	Dibutyl Phthalate results in decreased expression of DDX27 mRNA	CTD	PMID:21266533
Ddx27	Rat	dioxygen	multiple interactions	ISO	Ddx27 (Mus musculus)	6480464	[NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of DDX27 mRNA	CTD	PMID:30529165
Ddx27	Rat	doxorubicin	decreases expression	ISO	DDX27 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of DDX27 mRNA	CTD	PMID:29803840
Ddx27	Rat	ethanol	affects splicing	ISO	Ddx27 (Mus musculus)	6480464	Ethanol affects the splicing of DDX27 mRNA	CTD	PMID:30319688
Ddx27	Rat	ethanol	affects expression	ISO	Ddx27 (Mus musculus)	6480464	Ethanol affects the expression of DDX27 mRNA	CTD	PMID:30319688
Ddx27	Rat	flutamide	increases expression	EXP		6480464	Flutamide results in increased expression of DDX27 mRNA	CTD	PMID:24136188
Ddx27	Rat	haloperidol	increases expression	ISO	DDX27 (Homo sapiens)	6480464	Haloperidol results in increased expression of DDX27 protein	CTD	PMID:34122009
Ddx27	Rat	hydralazine	multiple interactions	ISO	DDX27 (Homo sapiens)	6480464	[Hydralazine co-treated with Valproic Acid] results in increased expression of DDX27 mRNA	CTD	PMID:17183730
Ddx27	Rat	ivermectin	decreases expression	ISO	DDX27 (Homo sapiens)	6480464	Ivermectin results in decreased expression of DDX27 protein	CTD	PMID:32959892
Ddx27	Rat	medroxyprogesterone acetate	multiple interactions	ISO	DDX27 (Homo sapiens)	6480464	[Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in increased expression of DDX27 mRNA	CTD	PMID:20823114
Ddx27	Rat	methotrexate	affects expression	ISO	Ddx27 (Mus musculus)	6480464	Methotrexate affects the expression of DDX27 mRNA	CTD	PMID:18502557
Ddx27	Rat	nitrates	multiple interactions	ISO	Ddx27 (Mus musculus)	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of DDX27 mRNA	CTD	PMID:35964746
Ddx27	Rat	ozone	multiple interactions	ISO	Ddx27 (Mus musculus)	6480464	[Air Pollutants results in increased abundance of Ozone] which results in decreased expression of DDX27 mRNA	CTD	PMID:27106289
Ddx27	Rat	paracetamol	affects expression	ISO	Ddx27 (Mus musculus)	6480464	Acetaminophen affects the expression of DDX27 mRNA	CTD	PMID:17562736
Ddx27	Rat	paraquat	increases expression	EXP		6480464	Paraquat results in increased expression of DDX27 mRNA	CTD	PMID:32680482
Ddx27	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Ddx27 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of DDX27 mRNA	CTD	PMID:36331819
Ddx27	Rat	pregnenolone 16alpha-carbonitrile	increases expression	ISO	Ddx27 (Mus musculus)	6480464	Pregnenolone Carbonitrile results in increased expression of DDX27 mRNA	CTD	PMID:28903501
Ddx27	Rat	resveratrol	decreases expression	ISO	Ddx27 (Mus musculus)	6480464	resveratrol results in decreased expression of DDX27 protein	CTD	PMID:25505154
Ddx27	Rat	resveratrol	multiple interactions	ISO	DDX27 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in increased expression of DDX27 mRNA	CTD	PMID:23557933
Ddx27	Rat	rimonabant	multiple interactions	ISO	Ddx27 (Mus musculus)	6480464	Rimonabant inhibits the reaction [Dietary Fats results in decreased expression of DDX27 mRNA]	CTD	PMID:19030233
Ddx27	Rat	rotenone	increases expression	EXP		6480464	Rotenone results in increased expression of DDX27 mRNA	CTD	PMID:19013527
Ddx27	Rat	SB 431542	multiple interactions	ISO	DDX27 (Homo sapiens)	6480464	[LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of DDX27 protein	CTD	PMID:37664457
Ddx27	Rat	sodium arsenite	decreases expression	ISO	Ddx27 (Mus musculus)	6480464	sodium arsenite results in decreased expression of DDX27 protein	CTD	PMID:29044176
Ddx27	Rat	sodium dichromate	increases expression	EXP		6480464	sodium bichromate results in increased expression of DDX27 mRNA	CTD	PMID:25993096
Ddx27	Rat	tetrachloromethane	increases expression	ISO	Ddx27 (Mus musculus)	6480464	Carbon Tetrachloride results in increased expression of DDX27 mRNA	CTD	PMID:27339419 and PMID:31919559
Ddx27	Rat	tetrachloromethane	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of DDX27 mRNA]	CTD	PMID:31150632
Ddx27	Rat	tetrachloromethane	increases expression	EXP		6480464	Carbon Tetrachloride results in increased expression of DDX27 mRNA	CTD	PMID:31150632
Ddx27	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of DDX27 mRNA	CTD	PMID:23411599 and PMID:34492290
Ddx27	Rat	tungsten	decreases expression	ISO	Ddx27 (Mus musculus)	6480464	Tungsten results in decreased expression of DDX27 mRNA	CTD	PMID:30912803
Ddx27	Rat	valproic acid	multiple interactions	ISO	DDX27 (Homo sapiens)	6480464	[Hydralazine co-treated with Valproic Acid] results in increased expression of DDX27 mRNA	CTD	PMID:17183730

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ddx27	Rat	rRNA processing	involved_in	ISO	DDX27 (Homo sapiens)	1624291	PMID:25825154	RGD	PMID:25825154

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ddx27	Rat	chromosome	located_in	ISO	DDX27 (Homo sapiens)	1624291	PMID:20813266	RGD	PMID:20813266
Ddx27	Rat	nucleolus	located_in	ISO	DDX27 (Homo sapiens)	1624291	PMID:25825154	RGD	PMID:25825154
Ddx27	Rat	nucleolus	is_active_in	IBA	PANTHER:PTN002773100 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ddx27	Rat	ATP binding	enables	IEA	UniProtKB-KW:KW-0067	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ddx27	Rat	ATP binding	enables	IEA	InterPro:IPR011545	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ddx27	Rat	helicase activity	enables	IEA	UniProtKB-KW:KW-0347	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ddx27	Rat	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ddx27	Rat	nucleic acid binding	enables	IEA	InterPro:IPR011545	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ddx27	Rat	nucleotide binding	enables	IEA	UniProtKB-KW:KW-0547	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ddx27	Rat	protein binding	enables	ISO	DDX27 (Homo sapiens)	1624291	UniProtKB:O00541 more ...	RGD	PMID:25825154
Ddx27	Rat	RNA helicase activity	enables	IEA	EC:3.6.4.13	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Ddx27	Rat	RNA helicase activity	enables	IEA	InterPro:IPR014014	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:20813266	PMID:22658674	PMID:22681889	PMID:25825154

Ddx27
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	176,163,220 - 176,182,418 (+)	NCBI		GRCr8
mRatBN7.2	3	155,744,182 - 155,763,380 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	155,744,150 - 155,763,372 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	159,545,494 - 159,564,670 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	168,044,467 - 168,063,643 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	165,786,175 - 165,805,351 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	163,767,236 - 163,786,408 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	163,767,173 - 163,786,445 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	169,927,524 - 169,946,728 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	158,165,670 - 158,185,490 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	158,071,719 - 158,091,133 (+)	NCBI
Celera	3	154,325,693 - 154,370,898 (+)	NCBI		Celera
Cytogenetic Map	3	q42	NCBI

DDX27
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	49,219,416 - 49,244,073 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	49,219,347 - 49,244,077 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	47,835,953 - 47,860,610 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	47,269,291 - 47,294,021 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	20	47,269,290 - 47,294,019	NCBI
Celera	20	44,540,460 - 44,565,227 (+)	NCBI		Celera
Cytogenetic Map	20	q13.13	NCBI
HuRef	20	44,584,608 - 44,609,377 (+)	NCBI		HuRef
CHM1_1	20	47,740,185 - 47,765,013 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	20	50,988,932 - 51,013,575 (+)	NCBI		T2T-CHM13v2.0

Ddx27
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	166,857,233 - 166,876,865 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	166,857,113 - 166,876,867 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	167,015,313 - 167,034,945 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	167,015,193 - 167,034,947 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	166,840,813 - 166,860,445 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	166,706,518 - 166,717,018 (+)	NCBI		MGSCv36	mm8
Celera	2	172,955,191 - 172,974,952 (+)	NCBI		Celera
Cytogenetic Map	2	H3	NCBI
cM Map	2	87.22	NCBI

Ddx27
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955445	8,881,062 - 8,899,905 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955445	8,881,062 - 8,899,895 (-)	NCBI	ChiLan1.0	ChiLan1.0

DDX27
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	54,960,971 - 54,986,235 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	54,954,077 - 54,979,335 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	45,557,430 - 45,582,569 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	46,626,761 - 46,647,238 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	46,621,585 - 46,647,238 (+)	Ensembl	panpan1.1		panPan2

DDX27
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	35,911,622 - 35,930,597 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	35,869,470 - 35,930,566 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	35,154,359 - 35,173,309 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	36,616,595 - 36,635,540 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	36,616,661 - 36,635,586 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	35,857,077 - 35,876,020 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	35,991,713 - 36,010,711 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	36,532,956 - 36,552,144 (+)	NCBI		UU_Cfam_GSD_1.0

Ddx27
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	189,537,864 - 189,555,889 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936514	4,990,617 - 5,009,569 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936514	4,992,028 - 5,009,516 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DDX27
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	50,903,284 - 50,924,807 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	50,903,247 - 50,923,484 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	57,224,578 - 57,234,021 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DDX27
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	14,741,882 - 14,766,900 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	14,742,113 - 14,766,933 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666050	63,231,975 - 63,256,926 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ddx27
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624790	6,100,414 - 6,123,048 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624790	6,105,222 - 6,123,022 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Ddx27
29 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	40
Count of miRNA genes:	36
Interacting mature miRNAs:	39
Transcripts:	ENSRNOT00000010806
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
12879876	Bw182	Body weight QTL 182		0.003	body mass (VT:0001259)	body weight (CMO:0000012)	3	145925360	166177555	Rat
2301411	Bp320	Blood pressure QTL 320		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	145925360	166177555	Rat
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
1300113	Bp176	Blood pressure QTL 176	3.9		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	145956084	157309487	Rat
12879872	Cm97	Cardiac mass QTL 97		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	145925360	166177555	Rat
1598877	Bp285	Blood pressure QTL 285	1.5	0.03	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	120538241	165538241	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	130656562	169034231	Rat
12879873	Cm96	Cardiac mass QTL 96		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	145925360	166177555	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
12879874	Cm98	Cardiac mass QTL 98		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	145925360	166177555	Rat
1298068	Bp167	Blood pressure QTL 167		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	141074471	169034231	Rat
12879875	Kidm64	Kidney mass QTL 64		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	145925360	166177555	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2298477	Eau4	Experimental allergic uveoretinitis QTL 4		0.0011	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	3	137398739	169034231	Rat
8552791	Vie2	Viral induced encephalitis QTL 2	4.1		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	3	145956084	169034231	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
2317883	Alcrsp26	Alcohol response QTL 26	1.8	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	3	145526770	169034231	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	112681431	157681431	Rat
1331726	Bp208	Blood pressure QTL 208	3.129		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	141339013	162184794	Rat
1598854	Memor10	Memory QTL 10	2		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	3	145956084	161299569	Rat
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	131635904	169034231	Rat
10755461	Coatc16	Coat color QTL 16			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	3	122438700	167438700	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	127162703	168026850	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	118839124	163839124	Rat
1300159	Kidm4	Kidney mass QTL 4	3.83		kidney mass (VT:0002707)	right kidney wet weight to body weight ratio (CMO:0001953)	3	121056165	157309487	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
631673	Iddm13	Insulin dependent diabetes mellitus QTL 13	1.3	0.663	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	3	130193298	161695983	Rat
1578666	Vnigr1	Vascular neointimal growth QTL 1	4.6		artery morphology trait (VT:0002191)	artery lumen area (CMO:0001409)	3	149040888	168026850	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	130656562	169034231	Rat
8552952	Pigfal13	Plasma insulin-like growth factor 1 level QTL 13			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	138799500	169034231	Rat
12879871	Am7	Aortic mass QTL 7		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	145925360	166177555	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	124122556	169034231	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat

RH141023

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	155,764,182 - 155,764,362 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	163,787,211 - 163,787,390	NCBI	Rnor6.0
Rnor_5.0	3	169,947,531 - 169,947,710	UniSTS	Rnor5.0
RGSC_v3.4	3	158,186,293 - 158,186,472	UniSTS	RGSC3.4
RH 3.4 Map	3	1471.1	UniSTS
Cytogenetic Map	3	q42	UniSTS

BG373974

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	155,763,103 - 155,763,303 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	163,786,132 - 163,786,331	NCBI	Rnor6.0
Rnor_5.0	3	169,946,452 - 169,946,651	UniSTS	Rnor5.0
RGSC_v3.4	3	158,185,214 - 158,185,413	UniSTS	RGSC3.4
RH 3.4 Map	3	1472.0	UniSTS
Cytogenetic Map	3	q42	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001135801	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC130053	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088338	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC160885	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000010806 ⟹ ENSRNOP00000010806

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	155,744,182 - 155,763,372 (+)	Ensembl
Rnor_6.0 Ensembl	3	163,767,173 - 163,786,445 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097996 ⟹ ENSRNOP00000077239

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	155,744,150 - 155,763,372 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000102129 ⟹ ENSRNOP00000087926

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	155,744,182 - 155,763,372 (+)	Ensembl

RefSeq Acc Id:

NM_001135801 ⟹ NP_001129273

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	176,163,220 - 176,182,418 (+)	NCBI
mRatBN7.2	3	155,744,182 - 155,763,380 (+)	NCBI
Rnor_6.0	3	163,767,236 - 163,786,408 (+)	NCBI
Rnor_5.0	3	169,927,524 - 169,946,728 (+)	NCBI
RGSC_v3.4	3	158,165,670 - 158,185,490 (+)	RGD
Celera	3	154,325,693 - 154,370,898 (+)	NCBI

Sequence:

show sequence

GCTGCATCTTCAACATGCTGGCGGAGCTCGGTTTCATCGGGACCATCGGCGAAAATGACGAGGTGCCGGTTGAACCCGAGTCGGATTCCGGAGACGAGGAGGAGGAGGGACCCATTGTGCTGGGCCTC
AAGCAGAAAGCCCTGCAGAAGAACCGCAGTGCTGACTTCAACCCTGACTTTGTTTTCACTGAGAAGCAGGGCACGTATGATGGTAGCTGGGCCCTGGCTGACGTCATGAGCCAGCTCAAGAAGAAGAG
GGCAGCCACTACCCTGGATGAGAAGATTGAGAAAGTACGGAAGAAAAGGAAAGCAGAGGATAAGGAAGCCAAGTCTGGGAAGGCAGAGGAGAAAGAAGGCCAGGAGGGCTCTGACCTGAAGGGGCAGG
AGAATCTAGGAGAGAATGAGGCAGGCTCCAAGGACGAAGAGTCTGAGACTGACTACTCCTCTGAGGATGAGGAGATCCTCACCAAAGCAGACACACTCAAAGTGAAGGAGAAGAAGAAGAAGAAGAAG
GGCCAGGAATCAGGAGGATTCTTTGAAGATGCATCTGAATATGACAAAAGCCTGACCTTCCAGGACATGAACCTCTCCCGGCCCCTCCTGAAGGCCATTACAGCCATGGGCTTCAAGCAGCCCACTCC
AATTCAGAAGGCATGCATTCCTGTGGGTCTGCTGGGGAAAGACATCTGCGCCTGCGCAGCTACTGGGACAGGCAAAACGGCAGCCTTTGCACTGCCAGTCTTAGAGCGTCTGATCTACAAGCCCCGTC
AGGCTGCGGTCACTCGAGTGCTGGTGCTGGTCCCCACCAGAGAGCTGGGCATCCAAGTGCACTCTGTCACCAAGCAGCTGGCCCAGTTCTGCAGCATCACTACCTGCCTGGCTGTGGGGGGCCTGGAT
GTGAAGTCTCAGGAAGCCGCTCTTCGGGCAGCACCAGACATCCTCATTGCCACTCCTGGCCGGCTCATCGACCACCTCCACAACTGCCCTTCCTTCCACCTGAGCAGCATTGAAGTGCTCATCTTGGA
CGAGGCTGACAGGATGCTGGATGAGTATTTTGAGGAGCAGATGAAGGAGATTATCCGAATGTGTTCCCACCACCGCCAGACCATGCTCTTCTCGGCCACCATGACAGATGAGGTGAAAGATCTGGCTT
CGGTCTCCTTAAAGAATCCTGTGCGGATATTTGTGAACAGCAACACAGATGTAGCTCCCTTCCTACGGCAAGAGTTCATCCGGATCCGGCCTAACAGGGAAGGGGACCGGGAAGCCATTGTGGCAGCT
CTACTGATGAGAACCTTTACTGACCACGTGATGCTGTTCACCCAGACCAAGAAGCAGGCCCATCGCATGCACATCCTCCTAGGGCTGCTGGGGCTGCAGGTGGGCGAGCTCCATGGTAACTTGTCACA
GACGCAGCGGCTGGAAGCTCTCCGGCGCTTTAAGGATGAACAGATTGACATCCTGGTAGCCACAGATGTGGCAGCCCGTGGGCTTGACATTGAAGGAGTGAAAACAGTGATCAACTTCACCATGCCCA
ACACTGTCAAACACTATGTGCACCGGGTGGGGCGAACTGCACGTGCTGGCAGGGCTGGGCGCTCTGTCTCTCTGGTGGGAGAAGAGGAGCGGAAGATGCTGAAGGAGATCGTAAAGGCTGCCAAGGCT
CCAGTGAAGGCTCGGATCCTTCCCCAGGATGTTATCCTCAAATTCCGGGACAAGATTGAGAAAATGGAGAAAGATGTGTATGCAGTGCTGCAGCTGGAGGCGGAGGAGAGAGAGGTGCAGCAGTCAGA
AGCCCAGATCGACACAGCACAGCGACTCTTATCCAAAGGGAAACAGACAGCAGACCAGGAACCTGAGAGGAGCTGGTTTCAGACCAAAGAAGAGAGGAAAAAGGAGAAGATTGCCAAGGCTCTGCAGG
AGTTTGACTTGGCCTTAAGAGGAAAGAAGAAAAGGAAGAAGTTTATGAAGGACGTCAAGAAAAAGGGGGAGATGACGGCGGAGGAGAGGTCCCAGTTTGAAATCCTCAAGGCACAGATGTTTGCAGAG
CGGCTGGCCAAGAGGAACCGCAGAACCAAGCGAGCACGGGCAATGCCTGAGGAAGAGCCTGCAGCAGGCCCTGCCAAGAAGCAGAAGCAGCACAAGAAGTCTGTGTTTGATGAAGAACTCACCAACAC
AAGCAAGAAGGCCCTGAAACAGTACCGGGCTGGCCCTTCCTTTGAAGAGAGGAAACAGTTAGGTCTGCCCCGCCAGAGGAGAGGGAACTTCAAGTCTAAGTCCAGGTACAAGAGAAAGAAGTAGTATG
AGTGGTGTGAAGAAGTTGGTGGGACAATTTTATATCCCTTCCCTGTGGGAAGTCATCTTGTCTTGGTCTGAATTTTTCCATTTATGAAACCCCAAACCCGAGGCTGGAGAGATGGCTCACTGGTTAAG
AGCACTGACTGTTCTTCCAGAGGACCGGAGTTCAAATCCCAGCAACCACATGGTGGCTCACAACCATCTGTAATGGGATCTGATGCCCTCTTCTGATGTGTCTGAAGACAGCTACCATGTACATACGT
ACATAAATAAAATCTTTAAAAACAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_001129273	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88338	(Get FASTA)	NCBI Sequence Viewer
	AAI60885	(Get FASTA)	NCBI Sequence Viewer
	EDL96426	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010806
	ENSRNOP00000010806.5
	ENSRNOP00000077239.1
	ENSRNOP00000087926.1

RefSeq Acc Id:

NP_001129273 ⟸ NM_001135801

- UniProtKB:

B1H269 (UniProtKB/TrEMBL), A0A8I5Y624 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MLAELGFIGTIGENDEVPVEPESDSGDEEEEGPIVLGLKQKALQKNRSADFNPDFVFTEKQGTYDGSWALADVMSQLKKKRAATTLDEKIEKVRKKRKAEDKEAKSGKAEEKEGQEGSDLKGQENLGE
NEAGSKDEESETDYSSEDEEILTKADTLKVKEKKKKKKGQESGGFFEDASEYDKSLTFQDMNLSRPLLKAITAMGFKQPTPIQKACIPVGLLGKDICACAATGTGKTAAFALPVLERLIYKPRQAAVT
RVLVLVPTRELGIQVHSVTKQLAQFCSITTCLAVGGLDVKSQEAALRAAPDILIATPGRLIDHLHNCPSFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTDEVKDLASVSLK
NPVRIFVNSNTDVAPFLRQEFIRIRPNREGDREAIVAALLMRTFTDHVMLFTQTKKQAHRMHILLGLLGLQVGELHGNLSQTQRLEALRRFKDEQIDILVATDVAARGLDIEGVKTVINFTMPNTVKH
YVHRVGRTARAGRAGRSVSLVGEEERKMLKEIVKAAKAPVKARILPQDVILKFRDKIEKMEKDVYAVLQLEAEEREVQQSEAQIDTAQRLLSKGKQTADQEPERSWFQTKEERKKEKIAKALQEFDLA
LRGKKKRKKFMKDVKKKGEMTAEERSQFEILKAQMFAERLAKRNRRTKRARAMPEEEPAAGPAKKQKQHKKSVFDEELTNTSKKALKQYRAGPSFEERKQLGLPRQRRGNFKSKSRYKRKK

hide sequence

Ensembl Acc Id:

ENSRNOP00000010806 ⟸ ENSRNOT00000010806

Ensembl Acc Id:

ENSRNOP00000087926 ⟸ ENSRNOT00000102129

Ensembl Acc Id:

ENSRNOP00000077239 ⟸ ENSRNOT00000097996

Protein Domains

DEAD-box RNA helicase Q Helicase ATP-binding Helicase C-terminal

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B1H269-F1-model_v2	AlphaFold	B1H269	1-761	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13692688

Promoter ID:

EPDNEW_R3213

Type:

multiple initiation site

Name:

Ddx27_1

Description:

DEAD-box helicase 27

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	163,767,219 - 163,767,279	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-46755	BioCyc
Ensembl Genes	ENSRNOG00000008081	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000010806	ENTREZGENE
	ENSRNOT00000010806.7	UniProtKB/TrEMBL
	ENSRNOT00000097996.1	UniProtKB/TrEMBL
	ENSRNOT00000102129.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.300	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7366630	IMAGE-MGC_LOAD
	IMAGE:7384442	IMAGE-MGC_LOAD
InterPro	DEAD_box_RNA_helicase	UniProtKB/TrEMBL
	DNA/RNA_helicase_C	UniProtKB/TrEMBL
	DNA/RNA_helicase_DEAD/DEAH_N	UniProtKB/TrEMBL
	Helicase_ATP-bd	UniProtKB/TrEMBL
	P-loop_NTPase	UniProtKB/TrEMBL
	RNA-helicase_DEAD-box_CS	UniProtKB/TrEMBL
	RNA_helicase_DEAD_Q_motif	UniProtKB/TrEMBL
KEGG Report	rno:362274	UniProtKB/TrEMBL
MGC_CLONE	MGC:109610	IMAGE-MGC_LOAD
	MGC:188296	IMAGE-MGC_LOAD
NCBI Gene	362274	ENTREZGENE
PANTHER	ATP-DEPENDENT RNA HELICASE RHLE-RELATED	UniProtKB/TrEMBL
	RNA HELICASE	UniProtKB/TrEMBL
Pfam	DEAD	UniProtKB/TrEMBL
	Helicase_C	UniProtKB/TrEMBL
PhenoGen	Ddx27	PhenoGen
PROSITE	DEAD_ATP_HELICASE	UniProtKB/TrEMBL
	HELICASE_ATP_BIND_1	UniProtKB/TrEMBL
	HELICASE_CTER	UniProtKB/TrEMBL
	Q_MOTIF	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000008081	RatGTEx
SMART	DEXDc	UniProtKB/TrEMBL
	HELICc	UniProtKB/TrEMBL
Superfamily-SCOP	SSF52540	UniProtKB/TrEMBL
UniProt	A0A8I5Y624	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A6U7_RAT	UniProtKB/TrEMBL
	A6JXI3_RAT	UniProtKB/TrEMBL
	B1H269	ENTREZGENE, UniProtKB/TrEMBL
	Q5I0G6_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-01-13	Ddx27	DEAD-box helicase 27	Ddx27	DEAD (Asp-Glu-Ala-Asp) box polypeptide 27	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-05-24	Ddx27	DEAD (Asp-Glu-Ala-Asp) box polypeptide 27	LOC686264	similar to Probable ATP-dependent RNA helicase DDX27 (DEAD box protein 27)	Data merged from RGD:1584300	1643240	APPROVED
2013-05-24	Ddx27	DEAD (Asp-Glu-Ala-Asp) box polypeptide 27	LOC688346	similar to Probable ATP-dependent RNA helicase DDX27 (DEAD box protein 27)	Data merged from RGD:1590027	1643240	APPROVED
2006-11-20	LOC688346	similar to Probable ATP-dependent RNA helicase DDX27 (DEAD box protein 27)			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	LOC686264	similar to Probable ATP-dependent RNA helicase DDX27 (DEAD box protein 27)			Symbol and Name status set to provisional	70820	PROVISIONAL
2005-12-06	Ddx27	DEAD (Asp-Glu-Ala-Asp) box polypeptide 27	Ddx27_predicted	DEAD (Asp-Glu-Ala-Asp) box polypeptide 27 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Ddx27_predicted	DEAD (Asp-Glu-Ala-Asp) box polypeptide 27 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar