Advanced Search (OLGA)

Gene: Sar1b (secretion associated, Ras related GTPase 1B) Rattus norvegicus

Analyze

Symbol:

Sar1b

Name:

secretion associated, Ras related GTPase 1B

RGD ID:

1305590

Description:

Predicted to enable G protein activity and amino acid sensor activity. Predicted to be involved in several processes, including COPII-coated vesicle budding; cellular response to leucine starvation; and lipoprotein transport. Predicted to act upstream of or within regulation of TORC1 signaling. Predicted to be located in cytosol. Predicted to be part of COPII vesicle coat. Predicted to be active in endoplasmic reticulum exit site and lysosomal membrane. Human ortholog(s) of this gene implicated in chylomicron retention disease. Orthologous to human SAR1B (secretion associated Ras related GTPase 1B); PARTICIPATES IN Endoplasmic Reticulum-associated degradation pathway; INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; acetamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

GTP-binding protein SAR1b; LOC287276; SAR1 gene homolog B; SAR1 gene homolog B (S. cerevisiae); SAR1 homolog B; SAR1 homolog B (S. cerevisiae); SAR1a gene homolog 2; SAR1a gene homolog 2 (S. cerevisiae); SARA1B; Sara2; small COPII coat GTPase SAR1B

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	36,525,365 - 36,555,009 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	36,519,384 - 36,555,005 (+)	Ensembl				GRCr8
mRatBN7.2	10	36,024,415 - 36,054,069 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	36,024,382 - 36,054,066 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	40,718,637 - 40,749,185 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	40,208,617 - 40,239,165 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	35,712,346 - 35,742,894 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	37,215,989 - 37,245,603 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	37,215,937 - 37,245,658 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	36,988,915 - 37,018,529 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	37,283,985 - 37,313,599 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	35,379,114 - 35,408,847 (+)	NCBI		Celera
RGSC_v3.1	10	37,290,414 - 37,320,029 (+)	NCBI
Cytogenetic Map	10	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

chylomicron retention disease (ISO,ISS)

genetic disease (ISO)

Hereditary Pancreatitis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

(S)-nicotine (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

2-methylcholine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

acetamide (EXP)

acrolein (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

alpha-Zearalanol (EXP)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP)

bisphenol AF (ISO)

bisphenol F (ISO)

buspirone (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

clobetasol (ISO)

clofibrate (ISO)

clofibric acid (EXP)

cobalt dichloride (EXP)

copper atom (ISO)

copper(0) (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

cyproconazole (ISO)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

disulfiram (ISO)

diuron (EXP)

dorsomorphin (ISO)

elemental selenium (ISO)

epoxiconazole (ISO)

ethanol (ISO)

folic acid (ISO)

geldanamycin (ISO)

gold atom (ISO)

gold(0) (ISO)

indometacin (ISO)

inulin (ISO)

isotretinoin (ISO)

ivermectin (ISO)

lead(0) (ISO)

leflunomide (EXP)

mercury dibromide (ISO)

methidathion (ISO)

methoxychlor (EXP)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

Monobutylphthalate (ISO)

N-nitrosodiethylamine (EXP)

nefazodone (EXP)

nicotine (ISO)

nimesulide (EXP)

ozone (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP,ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

propiconazole (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

rotenone (ISO)

SB 431542 (ISO)

selenium atom (ISO)

sodium arsenite (EXP,ISO)

tert-butyl hydroperoxide (ISO)

testosterone (ISO)

thapsigargin (EXP,ISO)

thimerosal (ISO)

thioacetamide (EXP)

trichloroethene (ISO)

trichostatin A (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

cellular response to leucine starvation (IEA,ISO)

COPII vesicle coating (IEA,ISO,ISS)

COPII-coated vesicle cargo loading (IEA,ISO,ISS)

endoplasmic reticulum to Golgi vesicle-mediated transport (IBA,IEA,ISO,ISS)

intracellular protein transport (IEA)

lipid export from cell (IEA,ISO)

lipid homeostasis (IEA,ISO,ISS)

lipoprotein transport (IEA,ISO,ISS)

membrane organization (IBA)

negative regulation of TORC1 signaling (IEA,ISO)

protein transport (IEA)

regulation of COPII vesicle coating (IBA)

regulation of lipid transport (IEA,ISO,ISS)

regulation of TORC1 signaling (IEA,ISO)

vesicle organization (IBA)

vesicle-mediated transport (IEA)

Cellular Component

COPII vesicle coat (IBA,IEA,ISO,ISS)

cytosol (IEA,ISO)

endoplasmic reticulum exit site (IBA,IEA,ISO,ISS)

endoplasmic reticulum membrane (IEA)

Golgi cisterna membrane (IEA)

lysosomal membrane (IEA,ISO)

Molecular Function

amino acid sensor activity (IEA,ISO)

G protein activity (IEA,ISO,ISS)

GTP binding (IEA)

GTPase activity (IBA,IEA)

hydrolase activity (IEA)

metal ion binding (IEA)

nucleotide binding (IEA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Endoplasmic Reticulum-associated degradation pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:12477932	PMID:21480366	PMID:22303004	PMID:22484643

Genomics

Comparative Map Data

Sar1b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	36,525,365 - 36,555,009 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	36,519,384 - 36,555,005 (+)	Ensembl				GRCr8
mRatBN7.2	10	36,024,415 - 36,054,069 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	36,024,382 - 36,054,066 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	40,718,637 - 40,749,185 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	40,208,617 - 40,239,165 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	35,712,346 - 35,742,894 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	37,215,989 - 37,245,603 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	37,215,937 - 37,245,658 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	36,988,915 - 37,018,529 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	37,283,985 - 37,313,599 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	35,379,114 - 35,408,847 (+)	NCBI		Celera
RGSC_v3.1	10	37,290,414 - 37,320,029 (+)	NCBI
Cytogenetic Map	10	q22	NCBI

SAR1B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	134,601,149 - 134,632,828 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	134,601,149 - 134,649,271 (-)	Ensembl			hg38	GRCh38
GRCh37	5	133,936,839 - 133,968,518 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	133,970,018 - 133,996,426 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	5	133,970,018 - 133,996,426	NCBI
Celera	5	130,062,739 - 130,094,663 (-)	NCBI		Celera
Cytogenetic Map	5	q31.1	NCBI
HuRef	5	129,123,090 - 129,154,586 (-)	NCBI		HuRef
CHM1_1	5	133,369,453 - 133,401,131 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	135,126,762 - 135,158,446 (-)	NCBI		T2T-CHM13v2.0

Sar1b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	51,654,490 - 51,682,780 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	51,654,514 - 51,682,752 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	11	51,763,663 - 51,791,953 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	51,763,687 - 51,791,925 (+)	Ensembl			mm10	GRCm38
MGSCv37	11	51,577,165 - 51,605,455 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	11	51,607,125 - 51,635,346 (+)	NCBI		MGSCv36	mm8
Celera	11	56,330,790 - 56,359,078 (+)	NCBI		Celera
Cytogenetic Map	11	B1.3	NCBI
cM Map	11	31.41	NCBI

Sar1b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955408	5,737,197 - 5,761,228 (-)	Ensembl
ChiLan1.0	NW_004955408	5,737,197 - 5,761,228 (-)	NCBI	ChiLan1.0	ChiLan1.0

SAR1B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	129,904,656 - 129,931,011 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	128,044,218 - 128,070,580 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	130,008,941 - 130,035,785 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	136,151,592 - 136,181,967 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	136,157,408 - 136,181,967 (-)	Ensembl			panPan2	panpan1.1

SAR1B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	22,713,459 - 22,743,190 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	22,717,942 - 22,743,124 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	21,458,574 - 21,488,325 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	23,515,054 - 23,544,792 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	23,515,063 - 23,544,692 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	22,214,621 - 22,244,324 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	22,080,820 - 22,110,561 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	22,723,081 - 22,752,825 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Sar1b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	113,695,139 - 113,722,293 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936647	703,291 - 723,577 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936647	697,930 - 723,577 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SAR1B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	136,843,955 - 136,874,213 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	2	136,848,843 - 136,874,248 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	142,463,692 - 142,489,104 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SAR1B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	37,409,666 - 37,433,462 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	37,406,770 - 37,444,447 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666034	40,492,068 - 40,527,647 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Sar1b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624733	37,704,590 - 37,733,933 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624733	37,704,577 - 37,733,773 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Sar1b
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	9	34,351,754 - 34,380,524 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Sar1b
198 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	82
Count of miRNA genes:	61
Interacting mature miRNAs:	78
Transcripts:	ENSRNOT00000006567
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61441	Btemp1	Thermal response to stress QTL 1	4		body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	10	35893451	64140567	Rat
152025229	Scl83	Serum cholesterol level QTL 83	4.33		blood cholesterol amount (VT:0000180)		10	36211556	69161158	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31796281	76796281	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15776754	60776754	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	27023535	98502431	Rat
2293669	Bmd33	Bone mineral density QTL 33	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	10	27443787	72443787	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	35509383	91417879	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1250554	64349221	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2293679	Bmd30	Bone mineral density QTL 30	3.5	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	27443787	72443787	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6877142	51877142	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	19939207	64939207	Rat
61332	Eau3	Experimental allergic uveoretinitis QTL 3		0.004	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	18035782	63035782	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	922197	45922197	Rat
2317754	Glom25	Glomerulus QTL 25	3.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	2103708	47103708	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18668419	63668419	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21833758	61843633	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28950353	73950353	Rat
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5893811	50893811	Rat
1358897	Stresp6	Stress response QTL 6	4.17	0.022	blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	35893263	64653589	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29800910	64653589	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	27443787	72443787	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14991535	86964295	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5893811	50893811	Rat
2293652	Bmd22	Bone mineral density QTL 22	4.9	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	27443787	72443787	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14991535	107556066	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22931373	91127454	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6660923	73950353	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5893811	50893811	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5893811	50893811	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	14653541	59653541	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15533012	73695498	Rat
634329	Pia15	Pristane induced arthritis QTL 15	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	24662123	73695339	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	27023535	61843633	Rat
2298480	Eau7	Experimental allergic uveoretinitis QTL 7		0.0049	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	35509383	80509383	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5893811	50893811	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29800910	91417879	Rat
2298495	Eae23	Experimental allergic encephalomyelitis QTL 23	16.93		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis duration (CMO:0001424)	10	16175525	61175525	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	20110614	65110614	Rat
634327	Hc4	Hypercalciuria QTL 4	2.4		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	10	1	38832698	Rat
1354614	Hpcl1	Hepatic cholesterol level QTL 1	3.3		liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	35893263	52293000	Rat
2289985	Bp305	Blood pressure QTL 305			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	29076978	74076978	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	27587226	96099902	Rat
631532	Cm50	Cardiac mass QTL 50	6.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	18035782	63035782	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
1600371	Mcs21	Mammary carcinoma susceptibility QTL 21	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	29377046	52699134	Rat
2293705	Bmd25	Bone mineral density QTL 25	7.1	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	27443787	72443787	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14991535	107713808	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31129113	76129113	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6864618	96620484	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	35509383	88177745	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	20110614	65110614	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	27023535	99451848	Rat

Markers in Region

BI302268

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	36,052,518 - 36,052,639 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	37,244,058 - 37,244,178	NCBI	Rnor6.0
Rnor_5.0	10	37,016,984 - 37,017,104	UniSTS	Rnor5.0
RGSC_v3.4	10	37,312,054 - 37,312,174	UniSTS	RGSC3.4
Celera	10	35,407,302 - 35,407,422	UniSTS
RH 3.4 Map	10	388.0	UniSTS
Cytogenetic Map	10	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
17	13	68	181	91	90	59	141	59	6	426	252	22	156	90	93	31	19	19

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001009622	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC110466	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088842	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DV713786	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214614	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215352	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215892	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216359	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216811	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217315	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217751	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219108	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219381	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220176	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220447	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220536	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224969	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227071	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233866	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000006567 ⟹ ENSRNOP00000006567

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	36,519,384 - 36,555,005 (+)	Ensembl
mRatBN7.2 Ensembl	10	36,024,382 - 36,053,594 (+)	Ensembl
Rnor_6.0 Ensembl	10	37,215,937 - 37,245,658 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000102256 ⟹ ENSRNOP00000077131

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	36,024,415 - 36,054,066 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000106684 ⟹ ENSRNOP00000097629

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	36,041,045 - 36,054,066 (+)	Ensembl

RefSeq Acc Id:

NM_001009622 ⟹ NP_001009622

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	36,525,365 - 36,555,009 (+)	NCBI
mRatBN7.2	10	36,024,415 - 36,054,069 (+)	NCBI
Rnor_6.0	10	37,215,989 - 37,245,603 (+)	NCBI
Rnor_5.0	10	36,988,915 - 37,018,529 (+)	NCBI
RGSC_v3.4	10	37,283,985 - 37,313,599 (+)	RGD
Celera	10	35,379,114 - 35,408,847 (+)	RGD

Sequence:

show sequence

GCGCTTTGCACAGCCGGCTCAGAGCGTGTAGGACGGGCACGGAGCAGGGTTGCGTTCTCTGGAG
TCGCAGACCCTGTAAGATCTGGATATGTCCTTCATATTTGACTGGATTTACAGTGGTTTCAGCA
GTGTGCTGCAGTTTCTAGGATTGTATAAAAAAACTGGTAAACTGGTATTCCTTGGATTGGATAA
TGCCGGGAAAACAACGTTGCTACACATGCTGAAAGATGACAGGCTTGGCCAGCACGTCCCAACA
CTACATCCCACTTCAGAGGAGCTCACTATTGCTGGCATGACGTTTACAACTTTTGATCTGGGTG
GGCATTTGCAAGCCCGAAGAGTATGGAAAAACTACCTTCCTGCTATCAATGGCATTGTATTTCT
TGTGGATTGTGCAGACCATGAAAGGCTGTTAGAATCAAAAGAAGAACTTGATTCACTAATGACA
GATGAAACCATTGCCAACGTGCCTATCCTAATTCTTGGAAACAAGATCGACAGGCCTGAAGCCA
TAAGTGAAGAGAGGTTACGAGAGATGTTTGGTTTATATGGTCAGACAACAGGAAAGGGCAGTGT
GTCACTGAAGGAGCTGAATGCCCGGCCTCTGGAAGTGTTCATGTGCAGTGTGCTAAAAAGGCAG
GGCTACGGGGAAGGCTTCCGCTGGATGGCGCAGTACATCGACTAGCAGCGGCCGGCCCACACTT
CCAGCCCTCAGACCCATCCCCAACATGCATAACTTGAATTCAATAGACTTTTGTTGGTTTCAGA
ATAGGTGTTTTTAGATTATTAATATATCTACCTGAGTGGGAATTGCAAACTGATTCAAGTTTGA
ATATCACAATGTTAGCTTTCTAATTCCACACAGATAGTTTTTACAGTTTCTAACCCCACATCAA
CCCATCACCGTTTATAAAGACCAGCTTCCCATCGGTACATTTGAAGCACTTTTTAACGATGTGA
GACTACAAATACAAACCATATTTAAAAGCTCATCATGTGAAACTTTTATGTACTTTTTGGAAAT
AGTTTTTCAATTTAGATTGTCTGCCTATCTTGTGTACAGTTAAAATCCGCTTATCAGTGATTGC
ATGATGCTTTACTGTTTTCAAGACTTTTTCTTATGCAAACGTCATGCAATAAAACAAACTCCAA
CGTTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001009622	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88842	(Get FASTA)	NCBI Sequence Viewer
	EDM04331	(Get FASTA)	NCBI Sequence Viewer
	EDM04332	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000006567
	ENSRNOP00000006567.3
GenBank Protein	Q5HZY2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001009622 ⟸ NM_001009622

- UniProtKB:

Q5HZY2 (UniProtKB/Swiss-Prot), A6HE76 (UniProtKB/TrEMBL), A0A8I5Y776 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSFIFDWIYSGFSSVLQFLGLYKKTGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEEL
TIAGMTFTTFDLGGHLQARRVWKNYLPAINGIVFLVDCADHERLLESKEELDSLMTDETIANVP
ILILGNKIDRPEAISEERLREMFGLYGQTTGKGSVSLKELNARPLEVFMCSVLKRQGYGEGFRW
MAQYID

hide sequence

Ensembl Acc Id:

ENSRNOP00000006567 ⟸ ENSRNOT00000006567

Ensembl Acc Id:

ENSRNOP00000097629 ⟸ ENSRNOT00000106684

Ensembl Acc Id:

ENSRNOP00000077131 ⟸ ENSRNOT00000102256

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5HZY2-F1-model_v2	AlphaFold	Q5HZY2	1-198	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697168

Promoter ID:

EPDNEW_R7690

Type:

initiation region

Name:

Sar1b_1

Description:

secretion associated, Ras related GTPase 1B

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	37,216,009 - 37,216,069	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305590	AgrOrtholog
BioCyc Gene	G2FUF-25186	BioCyc
Ensembl Genes	ENSRNOG00000004820	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000006567	ENTREZGENE
	ENSRNOT00000006567.7	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7303357	IMAGE-MGC_LOAD
InterPro	P-loop_NTPase	UniProtKB/Swiss-Prot
	Small_GTP-bd_dom	UniProtKB/Swiss-Prot
	Small_GTPase_ARF/SAR	UniProtKB/Swiss-Prot
	Small_GTPase_SAR1	UniProtKB/Swiss-Prot
KEGG Report	rno:287276	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105988	IMAGE-MGC_LOAD
NCBI Gene	287276	ENTREZGENE
PANTHER	PTHR45684	UniProtKB/Swiss-Prot
Pfam	Arf	UniProtKB/Swiss-Prot
PhenoGen	Sar1b	PhenoGen
PRINTS	SAR1GTPBP	UniProtKB/Swiss-Prot
PROSITE	SAR1	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000004820	RatGTEx
SMART	ARF	UniProtKB/Swiss-Prot
	SAR	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot
UniProt	A0A8I5Y776	ENTREZGENE
	A6HE76	ENTREZGENE, UniProtKB/TrEMBL
	A6HE77_RAT	UniProtKB/TrEMBL
	Q5HZY2	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2014-03-13	Sar1b	secretion associated, Ras related GTPase 1B	Sar1b	SAR1 homolog B (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-10-30	Sar1b	SAR1 homolog B (S. cerevisiae)	Sar1b	SAR1 gene homolog B (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Sar1b	SAR1 gene homolog B (S. cerevisiae)	Sara2	SAR1a gene homolog 2 (S. cerevisiae)	Symbol and Name updated	1299863	APPROVED
2005-12-06	Sara2	SAR1a gene homolog 2 (S. cerevisiae)	Sara2_predicted	SAR1a gene homolog 2 (S. cerevisiae) (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Sara2_predicted	SAR1a gene homolog 2 (S. cerevisiae) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)