Advanced Search (OLGA)

Gene: Lyar (Ly1 antibody reactive) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Lyar

Name:

Ly1 antibody reactive

RGD ID:

1305352

Description:

Predicted to enable several functions, including DNA-binding transcription factor binding activity; identical protein binding activity; and transcription regulator inhibitor activity. Predicted to be involved in several processes, including erythrocyte development; positive regulation of phagocytosis; and regulation of DNA-templated transcription. Predicted to be located in nucleoplasm and photoreceptor outer segment. Predicted to be active in nucleolus. Orthologous to human LYAR (Ly1 antibody reactive); INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

cell growth-regulating nucleolar protein; LOC289707; Ly1 antibody reactive clone; Ly1 antibody reactive homolog; Ly1 antibody reactive homolog (mouse)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	LYAR (Ly1 antibody reactive)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Lyar (Ly1 antibody reactive clone)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Lyar (Ly1 antibody reactive)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LYAR (Ly1 antibody reactive)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	LYAR (Ly1 antibody reactive)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Lyar (Ly1 antibody reactive)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	LYAR (Ly1 antibody reactive)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LYAR (Ly1 antibody reactive)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Lyar (Ly1 antibody reactive)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	HMCN1 (hemicentin 1)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Lyar (Ly1 antibody reactive clone)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	LYAR (Ly1 antibody reactive)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	lyar (Ly1 antibody reactive homolog (mouse))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG12909	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	C16C10.8	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	YCR087C-A	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	lyar	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	76,789,193 - 76,802,973 (-)	NCBI		GRCr8
mRatBN7.2	14	72,576,878 - 72,590,854 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	72,576,879 - 72,590,612 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	77,018,568 - 77,032,136 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	78,259,442 - 78,273,010 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	74,699,518 - 74,713,086 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	77,308,211 - 77,321,931 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	77,308,204 - 77,321,977 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	77,290,073 - 77,303,793 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	77,859,637 - 77,873,205 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	77,862,030 - 77,875,596 (-)	NCBI
Celera	14	71,527,386 - 71,540,966 (-)	NCBI		Celera
Cytogenetic Map	14	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Lyar	Rat	Ellis-Van Creveld syndrome		ISO	LYAR (Homo sapiens)	8554872	ClinVar Annotator: match by term: Ellis-van Creveld syndrome	ClinVar	PMID:17024374 more ...

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Lyar	Rat	(+)-schisandrin B	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of LYAR mRNA]	CTD	PMID:31150632
Lyar	Rat	1,2-dimethylhydrazine	increases expression	ISO	Lyar (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of LYAR mRNA	CTD	PMID:22206623
Lyar	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	Lyar (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of LYAR mRNA	CTD	PMID:17942748
Lyar	Rat	17alpha-ethynylestradiol	increases expression	ISO	Lyar (Mus musculus)	6480464	Ethinyl Estradiol results in increased expression of LYAR mRNA	CTD	PMID:17942748
Lyar	Rat	17beta-estradiol	increases expression	ISO	LYAR (Homo sapiens)	6480464	Estradiol results in increased expression of LYAR mRNA	CTD	PMID:23019147 more ...
Lyar	Rat	17beta-estradiol	decreases expression	EXP		6480464	Estradiol results in decreased expression of LYAR mRNA	CTD	PMID:32145629
Lyar	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Lyar (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of LYAR mRNA	CTD	PMID:17942748
Lyar	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of LYAR mRNA	CTD	PMID:34747641
Lyar	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Lyar (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of LYAR mRNA	CTD	PMID:21570461
Lyar	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	LYAR (Homo sapiens)	6480464	Tetrachlorodibenzodioxin results in decreased expression of LYAR mRNA	CTD	PMID:20106945 and PMID:21632981
Lyar	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Lyar (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in increased expression of LYAR mRNA	CTD	PMID:17942748 and PMID:19465110
Lyar	Rat	2,4-dinitrotoluene	affects expression	EXP		6480464	2 and 4-dinitrotoluene affects the expression of LYAR mRNA	CTD	PMID:21346803
Lyar	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2 and 6-dinitrotoluene affects the expression of LYAR mRNA	CTD	PMID:21346803
Lyar	Rat	2-methylcholine	affects expression	ISO	LYAR (Homo sapiens)	6480464	beta-methylcholine affects the expression of LYAR mRNA	CTD	PMID:21179406
Lyar	Rat	3,3',4,4',5-pentachlorobiphenyl	increases expression	EXP		6480464	3 more ...	CTD	PMID:23196670
Lyar	Rat	4,4'-diaminodiphenylmethane	decreases expression	ISO	Lyar (Mus musculus)	6480464	4 and 4'-diaminodiphenylmethane results in decreased expression of LYAR mRNA	CTD	PMID:18648102
Lyar	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	Lyar (Mus musculus)	6480464	bisphenol S results in increased expression of LYAR mRNA	CTD	PMID:39298647
Lyar	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	LYAR (Homo sapiens)	6480464	bisphenol S results in increased expression of LYAR protein	CTD	PMID:31945527
Lyar	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of LYAR mRNA	CTD	PMID:30047161
Lyar	Rat	acrolein	multiple interactions	ISO	LYAR (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with Ozone] results in increased oxidation of LYAR mRNA	CTD	PMID:32845096
Lyar	Rat	acrylamide	increases expression	EXP		6480464	Acrylamide results in increased expression of LYAR mRNA	CTD	PMID:28959563
Lyar	Rat	aflatoxin B1	increases methylation	ISO	LYAR (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of LYAR gene	CTD	PMID:27153756
Lyar	Rat	aflatoxin B1	increases expression	ISO	LYAR (Homo sapiens)	6480464	Aflatoxin B1 results in increased expression of LYAR mRNA	CTD	PMID:22100608 and PMID:27153756
Lyar	Rat	all-trans-retinoic acid	decreases expression	ISO	LYAR (Homo sapiens)	6480464	Tretinoin results in decreased expression of LYAR mRNA	CTD	PMID:23724009 and PMID:33167477
Lyar	Rat	amitrole	increases expression	EXP		6480464	Amitrole results in increased expression of LYAR mRNA	CTD	PMID:30047161
Lyar	Rat	antirheumatic drug	decreases expression	ISO	LYAR (Homo sapiens)	6480464	Antirheumatic Agents results in decreased expression of LYAR mRNA	CTD	PMID:24449571
Lyar	Rat	Aroclor 1254	decreases expression	ISO	Lyar (Mus musculus)	6480464	Chlorodiphenyl (54% Chlorine) results in decreased expression of LYAR mRNA	CTD	PMID:23650126
Lyar	Rat	arsane	multiple interactions	ISO	LYAR (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of LYAR mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of LYAR mRNA	CTD	PMID:39836092
Lyar	Rat	arsenic atom	multiple interactions	ISO	LYAR (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of LYAR mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of LYAR mRNA	CTD	PMID:39836092
Lyar	Rat	arsenite(3-)	decreases expression	ISO	Lyar (Mus musculus)	6480464	arsenite results in decreased expression of LYAR protein	CTD	PMID:37955338
Lyar	Rat	azoxystrobin	decreases expression	ISO	LYAR (Homo sapiens)	6480464	azoxystrobin results in decreased expression of LYAR mRNA	CTD	PMID:33512557
Lyar	Rat	benzo[a]pyrene	increases expression	ISO	Lyar (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of LYAR mRNA	CTD	PMID:22228805
Lyar	Rat	benzo[a]pyrene	increases expression	ISO	LYAR (Homo sapiens)	6480464	Benzo(a)pyrene results in increased expression of LYAR mRNA	CTD	PMID:32234424
Lyar	Rat	benzo[a]pyrene	decreases expression	ISO	LYAR (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased expression of LYAR mRNA	CTD	PMID:22316170
Lyar	Rat	benzo[a]pyrene diol epoxide I	increases expression	ISO	LYAR (Homo sapiens)	6480464	7 more ...	CTD	PMID:20018196
Lyar	Rat	bis(2-chloroethyl) sulfide	decreases expression	ISO	LYAR (Homo sapiens)	6480464	Mustard Gas results in decreased expression of LYAR mRNA	CTD	PMID:25102026
Lyar	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of LYAR mRNA	CTD	PMID:25181051 and PMID:34947998
Lyar	Rat	bisphenol A	increases expression	ISO	LYAR (Homo sapiens)	6480464	bisphenol A results in increased expression of LYAR mRNA	CTD	PMID:36232920 and PMID:36828454
Lyar	Rat	bisphenol A	increases methylation	ISO	LYAR (Homo sapiens)	6480464	bisphenol A results in increased methylation of LYAR gene	CTD	PMID:31601247
Lyar	Rat	bisphenol A	decreases expression	ISO	Lyar (Mus musculus)	6480464	bisphenol A results in decreased expression of LYAR mRNA	CTD	PMID:33221593
Lyar	Rat	bisphenol A	decreases expression	ISO	LYAR (Homo sapiens)	6480464	bisphenol A results in decreased expression of LYAR mRNA	CTD	PMID:29275510
Lyar	Rat	bisphenol F	decreases expression	ISO	Lyar (Mus musculus)	6480464	bisphenol F results in decreased expression of LYAR mRNA	CTD	PMID:38685157
Lyar	Rat	C60 fullerene	decreases expression	EXP		6480464	fullerene C60 results in decreased expression of LYAR mRNA	CTD	PMID:19167457
Lyar	Rat	cadmium atom	multiple interactions	ISO	LYAR (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of LYAR mRNA	CTD	PMID:35301059
Lyar	Rat	cadmium dichloride	multiple interactions	ISO	LYAR (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of LYAR mRNA	CTD	PMID:35301059
Lyar	Rat	calcitriol	decreases expression	ISO	LYAR (Homo sapiens)	6480464	Calcitriol results in decreased expression of LYAR mRNA	CTD	PMID:21592394
Lyar	Rat	calcitriol	multiple interactions	ISO	LYAR (Homo sapiens)	6480464	[Testosterone co-treated with Calcitriol] results in decreased expression of LYAR mRNA	CTD	PMID:21592394
Lyar	Rat	chlorpyrifos	decreases expression	ISO	Lyar (Mus musculus)	6480464	Chlorpyrifos results in decreased expression of LYAR mRNA	CTD	PMID:37019170
Lyar	Rat	chromium(6+)	affects expression	ISO	Lyar (Mus musculus)	6480464	chromium hexavalent ion affects the expression of LYAR mRNA	CTD	PMID:28472532
Lyar	Rat	copper atom	multiple interactions	ISO	LYAR (Homo sapiens)	6480464	[NSC 689534 binds to Copper] which results in decreased expression of LYAR mRNA	CTD	PMID:20971185
Lyar	Rat	copper atom	affects binding	ISO	LYAR (Homo sapiens)	6480464	LYAR protein binds to Copper	CTD	PMID:15359738
Lyar	Rat	copper(0)	multiple interactions	ISO	LYAR (Homo sapiens)	6480464	[NSC 689534 binds to Copper] which results in decreased expression of LYAR mRNA	CTD	PMID:20971185
Lyar	Rat	copper(0)	affects binding	ISO	LYAR (Homo sapiens)	6480464	LYAR protein binds to Copper	CTD	PMID:15359738
Lyar	Rat	copper(II) chloride	increases expression	ISO	LYAR (Homo sapiens)	6480464	cupric chloride results in increased expression of LYAR mRNA	CTD	PMID:38568856
Lyar	Rat	coumarin	decreases phosphorylation	ISO	LYAR (Homo sapiens)	6480464	coumarin results in decreased phosphorylation of LYAR protein	CTD	PMID:35688186
Lyar	Rat	coumestrol	increases expression	ISO	LYAR (Homo sapiens)	6480464	Coumestrol results in increased expression of LYAR mRNA	CTD	PMID:19167446
Lyar	Rat	cyclosporin A	increases expression	ISO	LYAR (Homo sapiens)	6480464	Cyclosporine results in increased expression of LYAR mRNA	CTD	PMID:20106945 and PMID:27989131
Lyar	Rat	dioxygen	decreases expression	ISO	LYAR (Homo sapiens)	6480464	Oxygen deficiency results in decreased expression of LYAR mRNA	CTD	PMID:26516004
Lyar	Rat	dioxygen	multiple interactions	ISO	Lyar (Mus musculus)	6480464	[NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of LYAR mRNA	CTD	PMID:30529165
Lyar	Rat	diuron	decreases expression	ISO	LYAR (Homo sapiens)	6480464	Diuron results in decreased expression of LYAR mRNA	CTD	PMID:35967413
Lyar	Rat	enzyme inhibitor	multiple interactions	ISO	LYAR (Homo sapiens)	6480464	[Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of LYAR protein	CTD	PMID:23301498
Lyar	Rat	ethanol	decreases expression	ISO	LYAR (Homo sapiens)	6480464	Ethanol results in decreased expression of LYAR mRNA	CTD	PMID:23378141
Lyar	Rat	ethyl methanesulfonate	decreases expression	ISO	LYAR (Homo sapiens)	6480464	Ethyl Methanesulfonate results in decreased expression of LYAR mRNA	CTD	PMID:23649840
Lyar	Rat	flutamide	increases expression	EXP		6480464	Flutamide results in increased expression of LYAR mRNA	CTD	PMID:24136188
Lyar	Rat	folic acid	decreases expression	ISO	Lyar (Mus musculus)	6480464	Folic Acid results in decreased expression of LYAR mRNA	CTD	PMID:25629700
Lyar	Rat	formaldehyde	decreases expression	ISO	LYAR (Homo sapiens)	6480464	Formaldehyde results in decreased expression of LYAR mRNA	CTD	PMID:23649840
Lyar	Rat	FR900359	affects phosphorylation	ISO	LYAR (Homo sapiens)	6480464	FR900359 affects the phosphorylation of LYAR protein	CTD	PMID:37730182
Lyar	Rat	hydrogen peroxide	affects expression	ISO	LYAR (Homo sapiens)	6480464	Hydrogen Peroxide affects the expression of LYAR mRNA	CTD	PMID:20044591
Lyar	Rat	ivermectin	decreases expression	ISO	LYAR (Homo sapiens)	6480464	Ivermectin results in decreased expression of LYAR protein	CTD	PMID:32959892
Lyar	Rat	manganese atom	multiple interactions	ISO	LYAR (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of LYAR mRNA	CTD	PMID:39836092
Lyar	Rat	manganese(0)	multiple interactions	ISO	LYAR (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of LYAR mRNA	CTD	PMID:39836092
Lyar	Rat	manganese(II) chloride	multiple interactions	ISO	LYAR (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of LYAR mRNA	CTD	PMID:39836092
Lyar	Rat	menadione	affects expression	ISO	LYAR (Homo sapiens)	6480464	Vitamin K 3 affects the expression of LYAR mRNA	CTD	PMID:20044591
Lyar	Rat	methimazole	increases expression	EXP		6480464	Methimazole results in increased expression of LYAR mRNA	CTD	PMID:30047161
Lyar	Rat	methyl methanesulfonate	decreases expression	ISO	LYAR (Homo sapiens)	6480464	Methyl Methanesulfonate results in decreased expression of LYAR mRNA	CTD	PMID:23649840
Lyar	Rat	methylmercury chloride	increases expression	ISO	LYAR (Homo sapiens)	6480464	methylmercuric chloride results in increased expression of LYAR mRNA	CTD	PMID:28001369
Lyar	Rat	nickel atom	increases expression	ISO	LYAR (Homo sapiens)	6480464	Nickel results in increased expression of LYAR mRNA	CTD	PMID:24768652 and PMID:25583101
Lyar	Rat	nitrates	multiple interactions	ISO	Lyar (Mus musculus)	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of LYAR mRNA	CTD	PMID:35964746
Lyar	Rat	ozone	multiple interactions	ISO	LYAR (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with Ozone] results in increased oxidation of LYAR mRNA	CTD	PMID:32845096
Lyar	Rat	paracetamol	decreases expression	ISO	LYAR (Homo sapiens)	6480464	Acetaminophen results in decreased expression of LYAR mRNA	CTD	PMID:22230336
Lyar	Rat	paraquat	increases expression	EXP		6480464	Paraquat results in increased expression of LYAR mRNA	CTD	PMID:32680482
Lyar	Rat	pentachlorophenol	increases expression	ISO	Lyar (Mus musculus)	6480464	Pentachlorophenol results in increased expression of LYAR mRNA	CTD	PMID:23892564
Lyar	Rat	phenobarbital	affects expression	ISO	LYAR (Homo sapiens)	6480464	Phenobarbital affects the expression of LYAR mRNA	CTD	PMID:19159669
Lyar	Rat	pirinixic acid	increases expression	ISO	Lyar (Mus musculus)	6480464	pirinixic acid results in increased expression of LYAR mRNA	CTD	PMID:18301758
Lyar	Rat	resveratrol	decreases expression	ISO	Lyar (Mus musculus)	6480464	resveratrol results in decreased expression of LYAR protein	CTD	PMID:25505154
Lyar	Rat	rotenone	decreases expression	ISO	LYAR (Homo sapiens)	6480464	Rotenone results in decreased expression of LYAR mRNA	CTD	PMID:33512557
Lyar	Rat	SB 431542	multiple interactions	ISO	LYAR (Homo sapiens)	6480464	[LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of LYAR protein	CTD	PMID:37664457
Lyar	Rat	silicon dioxide	increases expression	ISO	LYAR (Homo sapiens)	6480464	Silicon Dioxide analog results in increased expression of LYAR mRNA	CTD	PMID:25895662
Lyar	Rat	sodium arsenite	decreases expression	ISO	LYAR (Homo sapiens)	6480464	sodium arsenite results in decreased expression of LYAR mRNA	CTD	PMID:38568856
Lyar	Rat	sodium arsenite	multiple interactions	ISO	LYAR (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of LYAR mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of LYAR mRNA	CTD	PMID:39836092
Lyar	Rat	sodium dichromate	affects expression	EXP		6480464	sodium bichromate affects the expression of LYAR mRNA	CTD	PMID:22110744
Lyar	Rat	sulfadimethoxine	increases expression	EXP		6480464	Sulfadimethoxine results in increased expression of LYAR mRNA	CTD	PMID:30047161
Lyar	Rat	sunitinib	increases expression	ISO	LYAR (Homo sapiens)	6480464	Sunitinib results in increased expression of LYAR mRNA	CTD	PMID:31533062
Lyar	Rat	testosterone	multiple interactions	ISO	LYAR (Homo sapiens)	6480464	[Testosterone co-treated with Calcitriol] results in decreased expression of LYAR mRNA	CTD	PMID:21592394
Lyar	Rat	testosterone	decreases expression	ISO	LYAR (Homo sapiens)	6480464	Testosterone results in decreased expression of LYAR mRNA	CTD	PMID:21592394
Lyar	Rat	tetrachloromethane	increases expression	ISO	Lyar (Mus musculus)	6480464	Carbon Tetrachloride results in increased expression of LYAR mRNA	CTD	PMID:27339419 and PMID:31919559
Lyar	Rat	tetrachloromethane	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of LYAR mRNA]	CTD	PMID:31150632
Lyar	Rat	tetrachloromethane	increases expression	EXP		6480464	Carbon Tetrachloride results in increased expression of LYAR mRNA	CTD	PMID:31150632
Lyar	Rat	thapsigargin	decreases expression	EXP		6480464	Thapsigargin results in decreased expression of LYAR protein	CTD	PMID:35544339
Lyar	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of LYAR mRNA	CTD	PMID:34492290
Lyar	Rat	trichloroethene	decreases expression	EXP		6480464	Trichloroethylene results in decreased expression of LYAR mRNA	CTD	PMID:33387578
Lyar	Rat	trimellitic anhydride	increases expression	ISO	Lyar (Mus musculus)	6480464	trimellitic anhydride results in increased expression of LYAR mRNA	CTD	PMID:19042947
Lyar	Rat	triptonide	affects expression	ISO	Lyar (Mus musculus)	6480464	triptonide affects the expression of LYAR mRNA	CTD	PMID:33045310
Lyar	Rat	valproic acid	increases expression	ISO	LYAR (Homo sapiens)	6480464	Valproic Acid results in increased expression of LYAR mRNA	CTD	PMID:29154799
Lyar	Rat	valproic acid	affects expression	ISO	LYAR (Homo sapiens)	6480464	Valproic Acid affects the expression of LYAR mRNA	CTD	PMID:25979313
Lyar	Rat	vinclozolin	increases expression	EXP		6480464	vinclozolin results in increased expression of LYAR mRNA	CTD	PMID:23034163
Lyar	Rat	zearalenone	increases expression	ISO	LYAR (Homo sapiens)	6480464	Zearalenone results in increased expression of LYAR mRNA	CTD	PMID:36828454

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Lyar	Rat	erythrocyte development	involved_in	ISO	LYAR (Homo sapiens)	1624291	PMID:25092918	RGD	PMID:25092918
Lyar	Rat	erythrocyte development	involved_in	IEA	UniProtKB:Q9NX58 and ensembl:ENSP00000345917	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Lyar	Rat	erythrocyte development	involved_in	ISS	UniProtKB:Q9NX58	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Lyar	Rat	immune system process	involved_in	IEA	UniProtKB-KW:KW-0391	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Lyar	Rat	innate immune response	involved_in	IEA	UniProtKB-KW:KW-0399	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Lyar	Rat	negative regulation of innate immune response	involved_in	IEA	UniProtKB:Q9NX58 and ensembl:ENSP00000345917	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Lyar	Rat	negative regulation of innate immune response	involved_in	ISO	LYAR (Homo sapiens)	1624291	PMID:31413131	RGD	PMID:31413131
Lyar	Rat	negative regulation of transcription by RNA polymerase II	involved_in	ISO	Lyar (Mus musculus)	1624291	PMID:25092918	RGD	PMID:25092918
Lyar	Rat	negative regulation of transcription by RNA polymerase II	involved_in	IBA	MGI:107470 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Lyar	Rat	negative regulation of transcription by RNA polymerase II	involved_in	ISO	LYAR (Homo sapiens)	1624291	PMID:25092918 and PMID:31413131	RGD	PMID:25092918 and PMID:31413131
Lyar	Rat	negative regulation of transcription by RNA polymerase II	involved_in	ISS	UniProtKB:Q9NX58	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Lyar	Rat	negative regulation of transcription by RNA polymerase II	involved_in	IEA	UniProtKB:Q08288 and ensembl:ENSMUSP00000084791	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Lyar	Rat	negative regulation of transcription by RNA polymerase II	involved_in	IEA	UniProtKB:Q9NX58 and ensembl:ENSP00000345917	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Lyar	Rat	positive regulation of phagocytosis	involved_in	ISO	Lyar (Mus musculus)	1624291	PMID:25735755	RGD	PMID:25735755
Lyar	Rat	positive regulation of phagocytosis	involved_in	ISS	UniProtKB:Q08288	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Lyar	Rat	positive regulation of phagocytosis	involved_in	IEA	UniProtKB:Q08288 and ensembl:ENSMUSP00000084791	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Lyar	Rat	positive regulation of transcription by RNA polymerase I	involved_in	ISO	LYAR (Homo sapiens)	1624291	PMID:31504794	RGD	PMID:31504794
Lyar	Rat	positive regulation of transcription by RNA polymerase I	involved_in	IEA	UniProtKB:Q9NX58 and ensembl:ENSP00000345917	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Lyar	Rat	rRNA processing	involved_in	IEA	UniProtKB:Q9NX58 and ensembl:ENSP00000345917	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Lyar	Rat	rRNA processing	involved_in	IBA	PANTHER:PTN000318364 and UniProtKB:Q9NX58	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Lyar	Rat	rRNA processing	involved_in	ISS	UniProtKB:Q9NX58	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Lyar	Rat	rRNA processing	involved_in	ISO	LYAR (Homo sapiens)	1624291	PMID:24495227	RGD	PMID:24495227

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Lyar	Rat	cell projection	located_in	IEA	UniProtKB-KW:KW-0966	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Lyar	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Lyar	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Lyar	Rat	nucleolus	located_in	IEA	UniProtKB-SubCell:SL-0188	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Lyar	Rat	nucleolus	located_in	ISO	Lyar (Mus musculus)	1624291	PMID:8491376	RGD	PMID:8491376
Lyar	Rat	nucleolus	is_active_in	IBA	MGI:107470 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Lyar	Rat	nucleolus	located_in	ISO	LYAR (Homo sapiens)	1624291	PMID:24495227 more ...	RGD	GO_REF:0000052 more ...
Lyar	Rat	nucleolus	located_in	ISS	UniProtKB:Q9NX58	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Lyar	Rat	nucleolus	located_in	IEA	UniProtKB:Q9NX58 and ensembl:ENSP00000345917	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Lyar	Rat	nucleolus	located_in	IEA	UniProtKB:Q08288 and ensembl:ENSMUSP00000084791	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Lyar	Rat	nucleoplasm	located_in	IEA	UniProtKB:Q9NX58 and ensembl:ENSP00000345917	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Lyar	Rat	nucleoplasm	located_in	ISO	LYAR (Homo sapiens)	1624291		RGD	GO_REF:0000052
Lyar	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Lyar	Rat	nucleus	located_in	IEA	UniProtKB:Q9NX58 and ensembl:ENSP00000345917	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Lyar	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Lyar	Rat	nucleus	located_in	ISO	LYAR (Homo sapiens)	1624291	PMID:22720776 and PMID:25092918	RGD	PMID:22720776 and PMID:25092918
Lyar	Rat	nucleus	located_in	ISS	UniProtKB:Q9NX58	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Lyar	Rat	photoreceptor outer segment	located_in	ISS	UniProtKB:Q08288	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Lyar	Rat	photoreceptor outer segment	located_in	ISO	Lyar (Mus musculus)	1624291	PMID:25735755	RGD	PMID:25735755
Lyar	Rat	photoreceptor outer segment	located_in	IEA	UniProtKB-SubCell:SL-0458	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Lyar	Rat	photoreceptor outer segment	located_in	IEA	UniProtKB:Q08288 and ensembl:ENSMUSP00000084791	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Lyar	Rat	DNA binding	enables	ISS	UniProtKB:Q9NX58	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Lyar	Rat	DNA binding	enables	IBA	PANTHER:PTN000318364 and UniProtKB:Q9NX58	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Lyar	Rat	DNA binding	enables	IEA	InterPro:IPR039999	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Lyar	Rat	DNA binding	enables	ISO	LYAR (Homo sapiens)	1624291	PMID:25092918	RGD	PMID:25092918
Lyar	Rat	DNA binding	enables	IEA	UniProtKB:Q9NX58 and ensembl:ENSP00000345917	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Lyar	Rat	DNA-binding transcription factor binding	enables	IEA	UniProtKB:Q9NX58 and ensembl:ENSP00000345917	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Lyar	Rat	DNA-binding transcription factor binding	enables	ISO	LYAR (Homo sapiens)	1624291	UniProtKB:Q14653 and PMID:31413131	RGD	PMID:31413131
Lyar	Rat	identical protein binding	enables	IEA	UniProtKB:Q9NX58 and ensembl:ENSP00000345917	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Lyar	Rat	identical protein binding	enables	ISO	LYAR (Homo sapiens)	1624291	UniProtKB:Q9NX58 and PMID:32296183	RGD	PMID:32296183
Lyar	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Lyar	Rat	protein binding	enables	ISO	LYAR (Homo sapiens)	1624291	UniProtKB:A0A142I5B9 more ...	RGD	PMID:21516116 more ...
Lyar	Rat	transcription regulator inhibitor activity	enables	IEA	UniProtKB:Q9NX58 and ensembl:ENSP00000345917	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Lyar	Rat	transcription regulator inhibitor activity	enables	ISO	LYAR (Homo sapiens)	1624291	PMID:31413131	RGD	PMID:31413131
Lyar	Rat	zinc ion binding	enables	IEA	UniProtKB-KW:KW-0863	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:8491376	PMID:12477932	PMID:15489334	PMID:22658674	PMID:22681889	PMID:22720776	PMID:24495227	PMID:25092918	PMID:25735755	PMID:35352799

Lyar
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	76,789,193 - 76,802,973 (-)	NCBI		GRCr8
mRatBN7.2	14	72,576,878 - 72,590,854 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	72,576,879 - 72,590,612 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	77,018,568 - 77,032,136 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	78,259,442 - 78,273,010 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	74,699,518 - 74,713,086 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	77,308,211 - 77,321,931 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	77,308,204 - 77,321,977 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	77,290,073 - 77,303,793 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	77,859,637 - 77,873,205 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	77,862,030 - 77,875,596 (-)	NCBI
Celera	14	71,527,386 - 71,540,966 (-)	NCBI		Celera
Cytogenetic Map	14	q21	NCBI

LYAR
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	4,267,701 - 4,290,154 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	4,267,701 - 4,290,154 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	4,269,428 - 4,291,881 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	4,320,337 - 4,342,744 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	4	4,167,051 - 4,189,521 (-)	NCBI		Celera
Cytogenetic Map	4	p16.3	NCBI
HuRef	4	4,205,115 - 4,227,579 (-)	NCBI		HuRef
CHM1_1	4	4,267,309 - 4,289,782 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	4,237,159 - 4,259,618 (-)	NCBI		T2T-CHM13v2.0

Lyar
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	38,377,815 - 38,391,650 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	38,377,814 - 38,391,650 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	38,220,471 - 38,234,306 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	38,220,470 - 38,234,306 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	38,611,721 - 38,625,545 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	38,508,799 - 38,522,546 (+)	NCBI		MGSCv36	mm8
Celera	5	35,670,252 - 35,684,076 (+)	NCBI		Celera
Cytogenetic Map	5	B3	NCBI
cM Map	5	20.29	NCBI

Lyar
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955514	5,358,843 - 5,376,112 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955514	5,358,843 - 5,375,990 (+)	NCBI	ChiLan1.0	ChiLan1.0

LYAR
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	4,534,513 - 4,557,030 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	4,467,357 - 4,489,984 (-)	NCBI		NHGRI_mPanPan1
PanPan1.1	4	4,348,263 - 4,370,716 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	4,348,263 - 4,364,347 (-)	Ensembl	panpan1.1		panPan2

LYAR
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	69,710,735 - 69,724,175 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	69,710,735 - 69,724,177 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	72,262,732 - 72,281,663 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	70,467,687 - 70,486,622 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	3	70,467,692 - 70,486,574 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	3	69,741,785 - 69,760,718 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	69,906,935 - 69,925,842 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	70,288,339 - 70,307,278 (-)	NCBI		UU_Cfam_GSD_1.0

Lyar
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405285	63,232,715 - 63,257,046 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936477	16,934,401 - 16,958,722 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LYAR
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	6,081,368 - 6,099,857 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	6,081,332 - 6,099,861 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	5,776,295 - 5,794,805 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LYAR
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	27	40,410,849 - 40,433,942 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666047	87,211,025 - 87,233,986 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Lyar
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624755	21,434,144 - 21,450,124 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Lyar
38 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	15
Count of miRNA genes:	12
Interacting mature miRNAs:	14
Transcripts:	ENSRNOT00000007154
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313089	Bss81	Bone structure and strength QTL 81	3.4	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	14	37669719	82669719	Rat
9590294	Uminl4	Urine mineral level QTL 4	5.66	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	14	55624247	100624247	Rat
2300197	Scl59	Serum cholesterol level QTL 59			blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	14	55147478	100147478	Rat
70214	Niddm28	Non-insulin dependent diabetes mellitus QTL 28	4.06		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	39998251	75582726	Rat
70153	Bp59	Blood pressure QTL 59	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	14	68757796	83368335	Rat
70187	Pancm5	Pancreatic morphology QTL 5	16.7		pancreas mass (VT:0010144)	pancreas weight to body weight ratio (CMO:0000630)	14	30320092	80829842	Rat
631523	Pia13	Pristane induced arthritis QTL 13	3.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	14	40793460	98037301	Rat
1582259	Gluco23	Glucose level QTL 23	3.1	0.0008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	70053989	104886043	Rat
2313100	Bss82	Bone structure and strength QTL 82	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	14	37669719	82669719	Rat
634328	Hc5	Hypercalciuria QTL 5	2.3		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	14	58184885	103184885	Rat
2317879	Alcrsp27	Alcohol response QTL 27	3.3	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	14	56631369	101631369	Rat
1641900	Alcrsp11	Alcohol response QTL 11			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	14	70053989	104886043	Rat
631839	Niddm37	Non-insulin dependent diabetes mellitus QTL 37	3.37		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11030622	95876975	Rat
9589034	Epfw11	Epididymal fat weight QTL 11	6	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	14	55624247	100624247	Rat
2313048	Bss84	Bone structure and strength QTL 84	3.1	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	14	37669719	82669719	Rat
1300136	Rf22	Renal function QTL 22	3.9		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	14	42262529	95023211	Rat
1549834	Scl45	Serum cholesterol level QTL 45	5.8		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	14	50023211	95023211	Rat
738037	Hcas6	Hepatocarcinoma susceptibility QTL 6	2.93		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	14	39057237	83368335	Rat
2313084	Bss83	Bone structure and strength QTL 83	2.9	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	14	37669719	82669719	Rat

BE111765

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	72,576,960 - 72,577,115 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	77,308,294 - 77,308,448	NCBI	Rnor6.0
Rnor_5.0	14	77,290,156 - 77,290,310	UniSTS	Rnor5.0
RGSC_v3.4	14	77,859,716 - 77,859,870	UniSTS	RGSC3.4
Celera	14	71,527,465 - 71,527,619	UniSTS
Cytogenetic Map	14	q21	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001011911	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006251087	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272938	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272939	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272940	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272941	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC079008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473963	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000007154 ⟹ ENSRNOP00000007154

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	72,576,879 - 72,590,612 (-)	Ensembl
Rnor_6.0 Ensembl	14	77,308,218 - 77,321,783 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000084093 ⟹ ENSRNOP00000073585

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	72,577,497 - 72,590,612 (-)	Ensembl
Rnor_6.0 Ensembl	14	77,308,204 - 77,321,977 (-)	Ensembl

RefSeq Acc Id:

NM_001011911 ⟹ NP_001011911

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	76,789,197 - 76,802,765 (-)	NCBI
mRatBN7.2	14	72,576,882 - 72,590,451 (-)	NCBI
Rnor_6.0	14	77,308,215 - 77,321,783 (-)	NCBI
Rnor_5.0	14	77,290,073 - 77,303,793 (-)	NCBI
RGSC_v3.4	14	77,859,637 - 77,873,205 (-)	RGD
Celera	14	71,527,386 - 71,540,966 (-)	RGD

Sequence:

show sequence

GGCGGCATGGCCGCCTTCCTTGAGGACTCGCTCGCGGGCAAAATCTGGAGTTCTGAGCTGGAGACGTTGCATCCCGGTTTTTAGTCCGGCCCGATGGCATGGGCAAGAGTTCAAACCTGTATCAGAAA
ATATTTAATCATTTAACCAAAAATGGTATTTTTTACATGCAATGCATGTGGTGAATCCGTGAAGAAAATACAGGTGGAAAAGCACGTGTCTATTTGCAGAAACTGTGAATGTCTTTCTTGCATTGACT
GTGGGAAAGATTTCTGGGGTGACGACTACAAAAACCATGTGAAATGCATCAGTGAAGATCAGAAATACGGAGGCAAAGGCTATGAAGCCAAAACACACAAAGGTGATGTGAAACAGCAGGCATGGATT
CAGAAAATTAATGAGTTAATAAAGAAACCCAACGTCAGCCCCAAGGTGCGAGAACTTTTGCAGCAAATTAGTGCTTTTGACAATGTTCCCAGAAAAAAGGCGAAGTTTCAGAACTGGATGAGGAACAG
CCTGAAAGTGCACAGCGACTCTGTTCTGGAGCAGGTGTGGAACATCTTCTCCGAAGCAGCCAGCAGCGAGCAAGATCAGCAGCCACCCAGCCACATGGCAAAGCCAAATACAGAGGTCCCCACTAAGG
TTCCATCCACAAAAACAAATGGCACCACAGAGGAGCAAACAGAGGCAAAGAAGAATAAAAGAGAAAGGAAGGAAGAACGACAGAAGAGCAGGAAGAAAGAGAAGAAAGAGCTGAAGTTAGAAAACCAC
CAGGAAAATCTGAAGGGCCAGAAGCCAAAGAAGCGCAAAAAGGGCCAGGAGGCCGGACATGAGGCTGGTGGGGAGGATGCCGCGGAGGCCAACGGCGCCCCAGAGAAGAAGAGAGCCCGGGATGCACA
GGCTTCTGAAGAGGGAGCAGACAGAAATGGGGGCCCCGCGGAGGATGCTGATGAGGGGCCGACCAAGACAGCAGCAGGAAAACGGAAGCGGCAAAAGCACTCAGAAGTTGAGTCTGATAACAAGAAAA
AAAAGATGAAGTTGCCAGGGCAGCCTGAAGAGGGAGAGCCTGAGGACCATGAGGCTCCATCAAAAGGTAAATTCAACTGGAAGGGGACCATTAAAGCTGTTCTGAAACAGGCTCCAGACAACGAGATA
TCAGTCAAGAAGTTAAAGAAAAAGGTTATAGCTCAGTACCATGCGGTGATGAGTGACCATCACACATCGGAGGAGGAGCTCCTGGCCATCTTCAACAAGAAGATCAGCAGGAACCCCACCTTTAAGGT
GCTGAAGGACAAAGTTAAGCTTCTGAAGTGAGGGCTCTGTTGCGTCACACTCTACCATCCTATTGGCTACTTTCCTCTCTTTGTAAAATGTGTAATGAATTCTAACAGCCGGAAGATTGCTTCCTGAA
ACTTTTTAAGTTAAGGAAAAAATATATTTTTGTTAAAACTTTTATGAAAAAATAAAATATATCCTTGTCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_006251087 ⟹ XP_006251149

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	76,789,193 - 76,802,973 (-)	NCBI
mRatBN7.2	14	72,576,878 - 72,590,854 (-)	NCBI
Rnor_6.0	14	77,308,211 - 77,321,931 (-)	NCBI
Rnor_5.0	14	77,290,073 - 77,303,793 (-)	NCBI

Sequence:

show sequence

TTCTGCGCGGGGAAGCTGGGCGAGCCGGTGGCGGTGCTTCGCTGGGCGGCTGCAGCTCCACGTGCTCCTGGCGGCCGGTTGGGACCGTTGGCGGGGTCGGCTGAGAGGGCAAGAGTTCAAACCTGTAT
CAGAAAATATTTAATCATTTAACCAAAAATGGTATTTTTTACATGCAATGCATGTGGTGAATCCGTGAAGAAAATACAGGTGGAAAAGCACGTGTCTATTTGCAGAAACTGTGAATGTCTTTCTTGCA
TTGACTGTGGGAAAGATTTCTGGGGTGACGACTACAAAAACCATGTGAAATGCATCAGTGAAGATCAGAAATACGGAGGCAAAGGCTATGAAGCCAAAACACACAAAGGTGATGTGAAACAGCAGGCA
TGGATTCAGAAAATTAATGAGTTAATAAAGAAACCCAACGTCAGCCCCAAGGTGCGAGAACTTTTGCAGCAAATTAGTGCTTTTGACAATGTTCCCAGAAAAAAGGCGAAGTTTCAGAACTGGATGAG
GAACAGCCTGAAAGTGCACAGCGACTCTGTTCTGGAGCAGGTGTGGAACATCTTCTCCGAAGCAGCCAGCAGCGAGCAAGATCAGCAGCCACCCAGCCACATGGCAAAGCCAAATACAGAGGTCCCCA
CTAAGGTTCCATCCACAAAAACAAATGGCACCACAGAGGAGCAAACAGAGGCAAAGAAGAATAAAAGAGAAAGGAAGGAAGAACGACAGAAGAGCAGGAAGAAAGAGAAGAAAGAGCTGAAGTTAGAA
AACCACCAGGAAAATCTGAAGGGCCAGAAGCCAAAGAAGCGCAAAAAGGGCCAGGAGGCCGGACATGAGGCTGGTGGGGAGGATGCCGCGGAGGCCAACGGCGCCCCAGAGAAGAAGAGAGCCCGGGA
TGCACAGGCTTCTGAAGAGGGAGCAGACAGAAATGGGGGCCCCGCGGAGGATGCTGATGAGGGGCCGACCAAGACAGCAGCAGGAAAACGGAAGCGGCAAAAGCACTCAGAAGTTGAGTCTGATAACA
AGAAAAAAAAGATGAAGTTGCCAGGGCAGCCTGAAGAGGGAGAGCCTGAGGACCATGAGGCTCCATCAAAAGGTAAATTCAACTGGAAGGGGACCATTAAAGCTGTTCTGAAACAGGCTCCAGACAAC
GAGATATCAGTCAAGAAGTTAAAGAAAAAGGTTATAGCTCAGTACCATGCGGTGATGAGTGACCATCACACATCGGAGGAGGAGCTCCTGGCCATCTTCAACAAGAAGATCAGCAGGAACCCCACCTT
TAAGGTGCTGAAGGACAAAGTTAAGCTTCTGAAGTGAGGGCTCTGTTGCGTCACACTCTACCATCCTATTGGCTACTTTCCTCTCTTTGTAAAATGTGTAATGAATTCTAACAGCCGGAAGATTGCTT
CCTGAAACTTTTTAAGTTAAGGAAAAAATATATTTTTGTTAAAACTTTTATGAAAAAATAAAATATATCCTTGTCAAATGTC

hide sequence

RefSeq Acc Id:

XM_063272938 ⟹ XP_063129008

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	76,789,193 - 76,802,973 (-)	NCBI

RefSeq Acc Id:

XM_063272939 ⟹ XP_063129009

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	76,789,193 - 76,802,900 (-)	NCBI

RefSeq Acc Id:

XM_063272940 ⟹ XP_063129010

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	76,789,193 - 76,802,814 (-)	NCBI

RefSeq Acc Id:

XM_063272941 ⟹ XP_063129011

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	76,789,193 - 76,802,799 (-)	NCBI


Protein RefSeqs	NP_001011911	(Get FASTA)	NCBI Sequence Viewer
	XP_006251149	(Get FASTA)	NCBI Sequence Viewer
	XP_063129008	(Get FASTA)	NCBI Sequence Viewer
	XP_063129009	(Get FASTA)	NCBI Sequence Viewer
	XP_063129010	(Get FASTA)	NCBI Sequence Viewer
	XP_063129011	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79008	(Get FASTA)	NCBI Sequence Viewer
	EDM00005	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000007154
	ENSRNOP00000073585
GenBank Protein	Q6AYK5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001011911 ⟸ NM_001011911

- UniProtKB:

Q6AYK5 (UniProtKB/Swiss-Prot), A6IJU1 (UniProtKB/TrEMBL), A0A0G2K5W6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVFFTCNACGESVKKIQVEKHVSICRNCECLSCIDCGKDFWGDDYKNHVKCISEDQKYGGKGYEAKTHKGDVKQQAWIQKINELIKKPNVSPKVRELLQQISAFDNVPRKKAKFQNWMRNSLKVHSDS
VLEQVWNIFSEAASSEQDQQPPSHMAKPNTEVPTKVPSTKTNGTTEEQTEAKKNKRERKEERQKSRKKEKKELKLENHQENLKGQKPKKRKKGQEAGHEAGGEDAAEANGAPEKKRARDAQASEEGAD
RNGGPAEDADEGPTKTAAGKRKRQKHSEVESDNKKKKMKLPGQPEEGEPEDHEAPSKGKFNWKGTIKAVLKQAPDNEISVKKLKKKVIAQYHAVMSDHHTSEEELLAIFNKKISRNPTFKVLKDKVKL
LK

hide sequence

RefSeq Acc Id:	XP_006251149 ⟸ XM_006251087
- Peptide Label:	isoform X2
- UniProtKB:	Q6AYK5 (UniProtKB/Swiss-Prot), A6IJU1 (UniProtKB/TrEMBL), A0A0G2K5W6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MVFFTCNACGESVKKIQVEKHVSICRNCECLSCIDCGKDFWGDDYKNHVKCISEDQKYGGKGYE AKTHKGDVKQQAWIQKINELIKKPNVSPKVRELLQQISAFDNVPRKKAKFQNWMRNSLKVHSDSVLEQVWNIFSEAASSEQDQQPPSHMAKPNTEVPTKVPSTKTNGTTEEQTEAKKNKRERKEERQK SRKKEKKELKLENHQENLKGQKPKKRKKGQEAGHEAGGEDAAEANGAPEKKRARDAQASEEGADRNGGPAEDADEGPTKTAAGKRKRQKHSEVESDNKKKKMKLPGQPEEGEPEDHEAPSKGKFNWKG TIKAVLKQAPDNEISVKKLKKKVIAQYHAVMSDHHTSEEELLAIFNKKISRNPTFKVLKDKVKLLK hide sequence

Ensembl Acc Id:

ENSRNOP00000007154 ⟸ ENSRNOT00000007154

Ensembl Acc Id:

ENSRNOP00000073585 ⟸ ENSRNOT00000084093

RefSeq Acc Id:	XP_063129008 ⟸ XM_063272938
- Peptide Label:	isoform X1
- UniProtKB:	A0A8L2UI20 (UniProtKB/TrEMBL), A0A0G2K5W6 (UniProtKB/TrEMBL)

Protein Domains

Acetyl-coA carboxylase zinc finger Zinc finger C2H2 LYAR-type

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6AYK5-F1-model_v2	AlphaFold	Q6AYK5	1-386	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13699367

Promoter ID:

EPDNEW_R9892

Type:

initiation region

Name:

Lyar_2

Description:

Ly1 antibody reactive

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R9893

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	14	77,321,848 - 77,321,908	EPDNEW

RGD ID:

13699382

Promoter ID:

EPDNEW_R9893

Type:

initiation region

Name:

Lyar_1

Description:

Ly1 antibody reactive

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R9892

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	14	77,321,959 - 77,322,019	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-15384	BioCyc
Ensembl Genes	ENSRNOG00000005374	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000007154	ENTREZGENE
	ENSRNOT00000084093	ENTREZGENE
Gene3D-CATH	1.10.10.2100	UniProtKB/Swiss-Prot
	3.30.1490.490	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7113133	IMAGE-MGC_LOAD
InterPro	LYAR	UniProtKB/Swiss-Prot
	Znf-ACC	UniProtKB/Swiss-Prot
	Znf_C2H2_LYAR	UniProtKB/Swiss-Prot
	Znf_C2H2_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:289707	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93922	IMAGE-MGC_LOAD
NCBI Gene	289707	ENTREZGENE
PANTHER	CELL GROWTH-REGULATING NUCLEOLAR PROTEIN	UniProtKB/Swiss-Prot
	PTHR13100	UniProtKB/Swiss-Prot
Pfam	zf-ACC	UniProtKB/Swiss-Prot
	zf-LYAR	UniProtKB/Swiss-Prot
PhenoGen	Lyar	PhenoGen
PROSITE	ADH_ZINC	UniProtKB/Swiss-Prot
	ZF_C2HC_LYAR	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000005374	RatGTEx
Superfamily-SCOP	SSF57667	UniProtKB/Swiss-Prot
UniProt	A0A0G2K5W6	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2UI20	ENTREZGENE, UniProtKB/TrEMBL
	A6IJU1	ENTREZGENE, UniProtKB/TrEMBL
	LYAR_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-12-18	Lyar	Ly1 antibody reactive	Lyar	Ly1 antibody reactive homolog (mouse)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-18	Lyar	Ly1 antibody reactive homolog (mouse)	Lyar	Ly1 antibody reactive clone	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Lyar	Ly1 antibody reactive clone	Lyar_predicted	Ly1 antibody reactive clone (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Lyar_predicted	Ly1 antibody reactive clone (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar