Advanced Search (OLGA)

Gene: Batf (basic leucine zipper ATF-like transcription factor) Rattus norvegicus

Analyze

Symbol:

Batf

Name:

basic leucine zipper ATF-like transcription factor

RGD ID:

1304923

Description:

Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in several processes, including DNA damage response, signal transduction by p53 class mediator; hemopoiesis; and positive regulation of macromolecule biosynthetic process. Predicted to be located in cytoplasm. Predicted to be part of RNA polymerase II transcription regulator complex. Predicted to be active in nucleus. Orthologous to human BATF (basic leucine zipper ATF-like transcription factor); INTERACTS WITH 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine; acetamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

B-ATF; B-cell-activating transcription factor; basic leucine zipper transcription factor, ATF-like; basic leucine zipper transcriptional factor ATF-like; LOC299206

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	111,084,717 - 111,107,052 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	111,084,717 - 111,107,052 (+)	Ensembl				GRCr8
mRatBN7.2	6	105,353,715 - 105,376,051 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	105,353,715 - 105,376,051 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	105,523,736 - 105,546,059 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	105,822,615 - 105,844,937 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	105,192,265 - 105,214,586 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	109,562,415 - 109,584,541 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	109,562,587 - 109,584,545 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	118,868,534 - 118,890,817 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	109,793,076 - 109,817,614 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	103,181,553 - 103,203,804 (+)	NCBI		Celera
RGSC_v3.1	6	109,752,161 - 109,821,070 (+)	NCBI
Cytogenetic Map	6	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

acetamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

antirheumatic drug (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

Butylbenzyl phthalate (ISO)

carbon nanotube (ISO)

cefaloridine (EXP)

CGP 52608 (ISO)

chlorpyrifos (ISO)

choline (ISO)

chrysene (ISO)

clodronic acid (ISO)

clofibrate (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

cylindrospermopsin (ISO)

dibenz[a,h]anthracene (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

dioxygen (ISO)

elemental selenium (ISO)

folic acid (ISO)

gardiquimod (ISO)

genistein (ISO)

hexadecanoic acid (ISO)

Indeno[1,2,3-cd]pyrene (ISO)

L-methionine (ISO)

menadione (ISO)

nickel atom (ISO)

nitrates (ISO)

okadaic acid (ISO)

ozone (ISO)

paracetamol (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctanoic acid (EXP)

pirinixic acid (ISO)

protein kinase inhibitor (ISO)

selenium atom (ISO)

silicon dioxide (EXP,ISO)

sodium arsenate (ISO)

tetraphene (ISO)

thioacetamide (EXP)

titanium dioxide (EXP,ISO)

trimellitic anhydride (ISO)

urethane (ISO)

valproic acid (ISO)

vincristine (ISO)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

cell differentiation (IEA)

defense response to protozoan (IEA,ISO,ISS)

DNA damage response (IEA,ISO,ISS)

DNA damage response, signal transduction by p53 class mediator (IEA,ISO,ISS)

hematopoietic stem cell differentiation (IEA,ISO,ISS)

isotype switching (IEA,ISO,ISS)

lymphoid progenitor cell differentiation (IEA,ISO,ISS)

myeloid dendritic cell differentiation (IEA,ISO,ISS)

positive regulation of cytokine production (IEA,ISO,ISS)

positive regulation of transcription by RNA polymerase II (IEA,ISO)

regulation of DNA-templated transcription (IEA)

regulation of transcription by RNA polymerase II (IBA,IEA)

T-helper 17 cell differentiation (IEA,ISO,ISS)

T-helper 17 cell lineage commitment (IEA,ISO,ISS)

T-helper 2 cell differentiation (IEA,ISO,ISS)

Cellular Component

cytoplasm (IEA,ISO,ISS)

nucleoplasm (IEA,ISO)

nucleus (IBA,IEA,ISO,ISS)

RNA polymerase II transcription regulator complex (IEA,ISO)

Molecular Function

DNA binding (IEA)

DNA-binding transcription activator activity, RNA polymerase II-specific (IEA,ISO)

DNA-binding transcription factor activity (IEA,ISO,ISS)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

protein binding (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IEA,ISO)

sequence-specific DNA binding (IEA,ISO,ISS)

sequence-specific double-stranded DNA binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	The myelin vacuolation (mv) rat with a null mutation in the attractin gene.	Kuwamura M, etal., Lab Invest 2002 Oct;82(10):1279-86.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:19578362	PMID:20421391	PMID:21572431	PMID:22385964	PMID:22983707	PMID:22992523	PMID:22992524	PMID:27073891	PMID:30498928

Genomics

Comparative Map Data

Batf
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	111,084,717 - 111,107,052 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	111,084,717 - 111,107,052 (+)	Ensembl				GRCr8
mRatBN7.2	6	105,353,715 - 105,376,051 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	105,353,715 - 105,376,051 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	105,523,736 - 105,546,059 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	105,822,615 - 105,844,937 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	105,192,265 - 105,214,586 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	109,562,415 - 109,584,541 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	109,562,587 - 109,584,545 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	118,868,534 - 118,890,817 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	109,793,076 - 109,817,614 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	103,181,553 - 103,203,804 (+)	NCBI		Celera
RGSC_v3.1	6	109,752,161 - 109,821,070 (+)	NCBI
Cytogenetic Map	6	q31	NCBI

BATF
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	75,522,469 - 75,546,992 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	75,522,455 - 75,546,993 (+)	Ensembl			hg38	GRCh38
GRCh37	14	75,988,812 - 76,013,335 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	75,058,537 - 75,083,086 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	14	75,058,536 - 75,083,086	NCBI
Celera	14	56,026,856 - 56,051,425 (+)	NCBI		Celera
Cytogenetic Map	14	q24.3	NCBI
HuRef	14	56,156,725 - 56,181,293 (+)	NCBI		HuRef
CHM1_1	14	75,926,564 - 75,951,110 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	69,731,553 - 69,756,105 (+)	NCBI		T2T-CHM13v2.0

Batf
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	85,733,494 - 85,755,861 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	85,733,443 - 85,755,861 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	12	85,686,720 - 85,709,087 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	85,686,669 - 85,709,087 (+)	Ensembl			mm10	GRCm38
MGSCv37	12	87,027,670 - 87,050,037 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	12	86,575,823 - 86,598,190 (+)	NCBI		MGSCv36	mm8
Celera	12	87,146,468 - 87,168,966 (+)	NCBI		Celera
Cytogenetic Map	12	D2	NCBI
cM Map	12	39.78	NCBI

Batf
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955523	42,218 - 66,103 (-)	Ensembl
ChiLan1.0	NW_004955523	42,365 - 66,103 (-)	NCBI	ChiLan1.0	ChiLan1.0

BATF
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	76,606,588 - 76,631,386 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	75,822,909 - 75,847,891 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	56,075,768 - 56,100,749 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	74,919,115 - 74,943,652 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	74,919,115 - 74,943,652 (+)	Ensembl			panPan2	panpan1.1

BATF
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	48,537,036 - 48,561,154 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	48,220,828 - 48,244,133 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	48,762,172 - 48,785,468 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	48,762,223 - 48,785,160 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	48,435,017 - 48,458,307 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	48,456,502 - 48,479,787 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	48,852,769 - 48,876,074 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Batf
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	27,437,717 - 27,461,255 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936488	4,607,716 - 4,631,283 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936488	4,607,716 - 4,631,237 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

BATF
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	98,670,211 - 98,692,230 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	7	98,670,211 - 98,692,230 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	104,503,160 - 104,524,738 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

BATF
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	52,761,569 - 52,785,999 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	52,761,651 - 52,785,978 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666053	40,981,105 - 41,005,400 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Batf
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624734	26,118,754 - 26,139,468 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624734	26,118,840 - 26,139,328 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Batf
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	7	99,802,463 - 99,825,170 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Batf
225 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	175
Count of miRNA genes:	127
Interacting mature miRNAs:	144
Transcripts:	ENSRNOT00000011563
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	71278722	116278722	Rat
2293088	Iddm28	Insulin dependent diabetes mellitus QTL 28	5.21		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	6	68767270	135411972	Rat
1331799	Bp211	Blood pressure QTL 211	3.66407		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	88019181	136741135	Rat
10054138	Gmadr3	Adrenal mass QTL 3	3.68	0.00045	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	6	90871046	135871046	Rat
1581563	Uae33	Urinary albumin excretion QTL 33			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	93560258	136550638	Rat
1641917	Colcr5	Colorectal carcinoma resistance QTL 5	3.18	0.0009	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	6	98944780	143944780	Rat
61414	Pia3	Pristane induced arthritis QTL 3	4.5		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	6	100704576	136029228	Rat
71111	Iddm8	Insulin dependent diabetes mellitus QTL 8	1.9	0.002	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	6	110921244	147156653	Rat
724524	Uae2	Urinary albumin excretion QTL 2	2.7	0.0005	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	79198463	144254945	Rat
1358355	Srcrt4	Stress Responsive Cort QTL 4	6.39		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	106095977	147156653	Rat
737827	Hcar11	Hepatocarcinoma resistance QTL 11	4.4		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	6	46050607	116278722	Rat
2303624	Vencon5	Ventilatory control QTL 5	4.45		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	6	93778632	138778632	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	20859430	113082285	Rat
61329	Eae9	Experimental allergic encephalomyelitis QTL 9	3.7		body mass (VT:0001259)	change in body weight (CMO:0002045)	6	84490437	129490437	Rat
10054123	Srcrt6	Stress Responsive Cort QTL 6	2.5	0.0043	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	90871046	135871046	Rat
724536	Uae7	Urinary albumin excretion QTL 7	3.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	93560258	136550638	Rat
2313399	Anxrr28	Anxiety related response QTL 28			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	6	101593607	138161926	Rat
1576302	Schws4	Schwannoma susceptibility QTL 4		0.0078	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	78204640	123204640	Rat
1581550	Pur8	Proteinuria QTL 8			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	93560258	136550638	Rat
1300075	Glom7	Glomerulus QTL 7	5.6	0.0000002	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	6	76937178	121937178	Rat
1331789	Rf37	Renal function QTL 37	3.224		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	6	86494122	112380234	Rat
1331725	Bp212	Blood pressure QTL 212	3.52475		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	99437079	125323237	Rat
12801471	Schws9	Schwannoma susceptibility QTL 9			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	101593607	146593607	Rat
1331722	Thshl1	Thyroid stimulating hormone level QTL 1	11.7	0.0001	blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	6	99708426	112483760	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	11	63	132	91	90	59	92	59	6	351	187	11	105	81	90	31	11	11

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106748	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008764758	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473982	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000011563 ⟹ ENSRNOP00000011563

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	111,084,717 - 111,107,052 (+)	Ensembl
mRatBN7.2 Ensembl	6	105,353,715 - 105,376,051 (+)	Ensembl
Rnor_6.0 Ensembl	6	109,562,587 - 109,584,545 (+)	Ensembl

RefSeq Acc Id:

NM_001106748 ⟹ NP_001100218

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	111,084,717 - 111,107,052 (+)	NCBI
mRatBN7.2	6	105,353,715 - 105,376,051 (+)	NCBI
Rnor_6.0	6	109,562,617 - 109,584,541 (+)	NCBI
Rnor_5.0	6	118,868,534 - 118,890,817 (+)	NCBI
RGSC_v3.4	6	109,793,076 - 109,817,614 (+)	RGD
Celera	6	103,181,553 - 103,203,804 (+)	RGD

Sequence:

show sequence

GCCTGTGCGCAAGCCCCAAAGTGAGCGAGATGTCCCTGTGGGGAGCAGTCCCTCTGCACCCCAG
AGAGAGGAGGACGCAGGGGTCTATCGGAGATAGCTGCAGGACGAGCAGGGGAGGCACCTGTGGA
AGGTGGTACGCTGCTGGCCCCCTGGCAGTCAAGAAGGGGAGCTTGCTAGTGAGAAGATCGCCCA
GAGGCATCTGGGACAGTGTGGGAGAGTCCGGAAGATTACAACCATGCCTCACAGCTCCGACAGC
AGCGACTCCAGCTTCAGCCGCTCTCCTCCCCCCGGCAAGCAGGACTCATCCGATGATGTGAGGA
AAGTTCAGAGGAGAGAGAAGAACCGCATTGCTGCCCAGAAGAGCCGACAGAGACAGACACAGAA
GGCCGACACCCTTCACCTGGAGAGCGAGGACCTGGAGAAACAGAATGCGGCTCTTCGAAAAGAG
ATCAAACAGCTCACAGAGGAGCTAAAGTACTTCACATCGGTGCTGAGCAGCCACGAGCCCCTGT
GCTCCGTGCTAGCCAGTGGCACCCCCTCGCCCCCCGAGGTGGTATACAGCGCCCATGCCTTCCA
CCAGCCTCACATCAGCTCACCACGCTTCCAGCCCTGAGCTTCTGGATGAGAAGAGAACAAAGCC
ATGGTCGATGCTACTCCTGTGATCCTATGGAGGGGCCATGCAAACTGAGGCCAGGCTGCCCTCA
TACCTCTATCCAGAGGCCCAGTGACAGAGGCCTGGACAAATATTGAACACAAGGACCATAGTGG
TCCAAGAGACATGAGGCATCCCGGGAAAGTATAGTCAATGTACTGAACTCTCCCGGGGAAATCT
AGCCCATGTACTGGACCCAGAAACTGACGAAACAACCCTGGAGTGTCAGTGTCGCCAATTATGC
CCAAGATGCAACGCACAGAGGGAGGAGGGCAGGGGATGTAGAGTTTTCTAAATAAATATTTTCC
AAGAAACAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001100218	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	D4A7E1	(Get FASTA)	NCBI Sequence Viewer
	EDL81581	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000011563
	ENSRNOP00000011563.4

RefSeq Acc Id:	NP_001100218 ⟸ NM_001106748
- UniProtKB:	D4A7E1 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MPHSSDSSDSSFSRSPPPGKQDSSDDVRKVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQ NAALRKEIKQLTEELKYFTSVLSSHEPLCSVLASGTPSPPEVVYSAHAFHQPHISSPRFQP hide sequence

Ensembl Acc Id:

ENSRNOP00000011563 ⟸ ENSRNOT00000011563

Protein Domains

bZIP

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A7E1-F1-model_v2	AlphaFold	D4A7E1	1-125	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1304923	AgrOrtholog
BioCyc Gene	G2FUF-36775	BioCyc
Ensembl Genes	ENSRNOG00000008588	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000011563	ENTREZGENE
	ENSRNOT00000011563.8	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.5.170	UniProtKB/Swiss-Prot
InterPro	AP-1	UniProtKB/Swiss-Prot
	bZIP	UniProtKB/Swiss-Prot
	bZIP_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:299206	UniProtKB/Swiss-Prot
NCBI Gene	299206	ENTREZGENE
PANTHER	PTHR23351	UniProtKB/Swiss-Prot
	PTHR23351:SF14	UniProtKB/Swiss-Prot
Pfam	bZIP_1	UniProtKB/Swiss-Prot
PhenoGen	Batf	PhenoGen
PRINTS	LEUZIPPRFOS	UniProtKB/Swiss-Prot
PROSITE	BZIP	UniProtKB/Swiss-Prot
	BZIP_BASIC	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000008588	RatGTEx
SMART	BRLZ	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF57959	UniProtKB/Swiss-Prot
UniProt	BATF_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-01	Batf	basic leucine zipper ATF-like transcription factor	Batf	basic leucine zipper transcription factor, ATF-like	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Batf	basic leucine zipper transcription factor, ATF-like	Batf_predicted	basic leucine zipper transcription factor, ATF-like (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Batf_predicted	basic leucine zipper transcription factor, ATF-like (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message