Symbol:
Trpm3
Name:
transient receptor potential cation channel, subfamily M, member 3
RGD ID:
1304888
Description:
Predicted to enable calcium channel activity. Predicted to be involved in calcium ion transmembrane transport. Predicted to act upstream of or within monoatomic cation transport. Predicted to be active in plasma membrane. Human ortholog(s) of this gene implicated in cataract. Orthologous to human TRPM3 (transient receptor potential cation channel subfamily M member 3); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; aflatoxin B1.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC309407; transient receptor potential cation channel subfamily M member 3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TRPM3 (transient receptor potential cation channel subfamily M member 3) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther
Mus musculus (house mouse):
Trpm3 (transient receptor potential cation channel, subfamily M, member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Trpm3 (transient receptor potential cation channel subfamily M member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TRPM3 (transient receptor potential cation channel subfamily M member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TRPM3 (transient receptor potential cation channel subfamily M member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Trpm3 (transient receptor potential cation channel subfamily M member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TRPM3 (transient receptor potential cation channel subfamily M member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TRPM3 (transient receptor potential cation channel subfamily M member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Trpm3 (transient receptor potential cation channel subfamily M member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
RARA (retinoic acid receptor alpha) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
TRPM3 (transient receptor potential cation channel subfamily M member 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Trpm3 (transient receptor potential cation channel, subfamily M, member 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
trpm3 (transient receptor potential cation channel, subfamily M, member 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
gon-2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Trpm
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
gtl-1
Alliance
DIOPT (OMA|OrthoFinder|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
gtl-2
Alliance
DIOPT (OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
trpm3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 229,099,741 - 229,984,172 (+) NCBI GRCr8 mRatBN7.2 1 219,673,200 - 220,557,610 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 219,672,892 - 220,560,717 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 228,126,334 - 228,996,882 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 235,056,436 - 235,926,937 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 227,874,450 - 228,744,986 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 239,741,572 - 240,757,583 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 240,355,149 - 240,757,583 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 247,027,120 - 247,810,732 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 1 247,942,661 - 248,041,913 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 225,377,097 - 226,276,992 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 225,865,833 - 226,439,441 (+) NCBI Celera 1 216,900,275 - 217,774,744 (+) NCBI Celera Cytogenetic Map 1 q51 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Trpm3 Rat 1,2-dichloroethane decreases expression ISO Trpm3 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of TRPM3 mRNA CTD PMID:28960355 Trpm3 Rat 2,2',5,5'-tetrachlorobiphenyl increases expression ISO TRPM3 (Homo sapiens) 6480464 2 more ... CTD PMID:36804509 Trpm3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Trpm3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TRPM3 mRNA CTD PMID:21570461 Trpm3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of TRPM3 mRNA CTD PMID:33387578 Trpm3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Trpm3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of TRPM3 mRNA CTD PMID:33956508 Trpm3 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of TRPM3 mRNA CTD PMID:24780913 and PMID:30047161 Trpm3 Rat aflatoxin B1 increases methylation ISO TRPM3 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of TRPM3 intron CTD PMID:30157460 Trpm3 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of TRPM3 mRNA CTD PMID:33354967 Trpm3 Rat aflatoxin B1 decreases methylation ISO TRPM3 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of TRPM3 gene CTD PMID:27153756 Trpm3 Rat all-trans-retinoic acid decreases expression ISO TRPM3 (Homo sapiens) 6480464 Tretinoin results in decreased expression of TRPM3 mRNA CTD PMID:21934132 Trpm3 Rat all-trans-retinoic acid multiple interactions ISO Trpm3 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of TRPM3 mRNA CTD PMID:36189433 Trpm3 Rat all-trans-retinoic acid increases expression ISO Trpm3 (Mus musculus) 6480464 Tretinoin results in increased expression of TRPM3 mRNA CTD PMID:36189433 Trpm3 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of TRPM3 mRNA CTD PMID:30047161 Trpm3 Rat amphotericin B decreases expression ISO TRPM3 (Homo sapiens) 6480464 Amphotericin B analog results in decreased expression of TRPM3 mRNA CTD PMID:28534445 Trpm3 Rat antirheumatic drug decreases expression ISO TRPM3 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of TRPM3 mRNA CTD PMID:24449571 Trpm3 Rat arsenous acid increases expression ISO TRPM3 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of TRPM3 mRNA CTD PMID:20458559 Trpm3 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of TRPM3 gene CTD PMID:35440735 Trpm3 Rat benzo[a]pyrene increases expression ISO Trpm3 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of TRPM3 mRNA CTD PMID:27195522 Trpm3 Rat benzo[a]pyrene decreases methylation ISO Trpm3 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of TRPM3 intron CTD PMID:27901495 Trpm3 Rat benzo[a]pyrene affects methylation ISO TRPM3 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of TRPM3 promoter CTD PMID:27901495 Trpm3 Rat bis(2-ethylhexyl) phthalate decreases expression ISO TRPM3 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of TRPM3 mRNA CTD PMID:31163220 Trpm3 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of TRPM3 mRNA CTD PMID:25181051 Trpm3 Rat bisphenol A increases expression ISO Trpm3 (Mus musculus) 6480464 bisphenol A results in increased expression of TRPM3 mRNA CTD PMID:35598803 Trpm3 Rat bisphenol A multiple interactions ISO TRPM3 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of TRPM3 gene CTD PMID:31601247 Trpm3 Rat bisphenol A increases methylation ISO TRPM3 (Homo sapiens) 6480464 bisphenol A results in increased methylation of TRPM3 gene CTD PMID:31601247 Trpm3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TRPM3 mRNA CTD PMID:34947998 Trpm3 Rat bromobenzene decreases expression EXP 6480464 bromobenzene results in decreased expression of TRPM3 mRNA CTD PMID:32479839 Trpm3 Rat carbamazepine affects expression ISO TRPM3 (Homo sapiens) 6480464 Carbamazepine affects the expression of TRPM3 mRNA CTD PMID:25979313 Trpm3 Rat CGP 52608 multiple interactions ISO TRPM3 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to TRPM3 gene] CTD PMID:28238834 Trpm3 Rat chlordecone increases expression ISO Trpm3 (Mus musculus) 6480464 Chlordecone results in increased expression of TRPM3 mRNA CTD PMID:33711761 Trpm3 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of TRPM3 mRNA CTD PMID:26577399 and PMID:27523638 Trpm3 Rat cyclosporin A increases expression ISO TRPM3 (Homo sapiens) 6480464 Cyclosporine results in increased expression of TRPM3 mRNA CTD PMID:22147139 Trpm3 Rat diarsenic trioxide increases expression ISO TRPM3 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of TRPM3 mRNA CTD PMID:20458559 Trpm3 Rat dorsomorphin multiple interactions ISO TRPM3 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Trpm3 Rat doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of TRPM3 mRNA CTD PMID:32289291 Trpm3 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of TRPM3 mRNA CTD PMID:29391264 Trpm3 Rat entinostat decreases expression ISO TRPM3 (Homo sapiens) 6480464 entinostat results in decreased expression of TRPM3 mRNA CTD PMID:26272509 Trpm3 Rat entinostat multiple interactions ISO TRPM3 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of TRPM3 mRNA CTD PMID:27188386 Trpm3 Rat ethanol increases expression ISO Trpm3 (Mus musculus) 6480464 Ethanol results in increased expression of TRPM3 mRNA CTD PMID:30319688 Trpm3 Rat fulvestrant multiple interactions ISO TRPM3 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of TRPM3 gene CTD PMID:31601247 Trpm3 Rat genistein decreases expression ISO Trpm3 (Mus musculus) 6480464 Genistein results in decreased expression of TRPM3 mRNA CTD PMID:32186404 Trpm3 Rat glyphosate decreases methylation EXP 6480464 Glyphosate results in decreased methylation of TRPM3 gene CTD PMID:31011160 Trpm3 Rat liquiritigenin decreases activity ISO Trpm3 (Mus musculus) 6480464 liquiritigenin results in decreased activity of TRPM3 protein CTD PMID:25361167 Trpm3 Rat maneb multiple interactions ISO Trpm3 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of TRPM3 mRNA and [Paraquat co-treated with Maneb] affects the expression of TRPM3 mRNA CTD PMID:22563483 and PMID:36117858 Trpm3 Rat methamphetamine affects response to substance ISO TRPM3 (Homo sapiens) 6480464 TRPM3 gene SNP affects the susceptibility to Methamphetamine CTD PMID:18316681 Trpm3 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of TRPM3 gene CTD PMID:35440735 Trpm3 Rat methylmercury chloride increases expression ISO TRPM3 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of TRPM3 mRNA CTD PMID:23179753 and PMID:27188386 Trpm3 Rat methylmercury chloride decreases expression ISO TRPM3 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of TRPM3 mRNA CTD PMID:28001369 Trpm3 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Trpm3 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of TRPM3 mRNA CTD PMID:36189433 Trpm3 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of TRPM3 mRNA CTD PMID:32479839 Trpm3 Rat paracetamol decreases expression ISO TRPM3 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of TRPM3 mRNA CTD PMID:29067470 Trpm3 Rat paraquat multiple interactions ISO Trpm3 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of TRPM3 mRNA and [Paraquat co-treated with Maneb] affects the expression of TRPM3 mRNA CTD PMID:22563483 and PMID:36117858 Trpm3 Rat paraquat increases expression ISO Trpm3 (Mus musculus) 6480464 Paraquat results in increased expression of TRPM3 mRNA CTD PMID:22563483 Trpm3 Rat pregnenolone sulfate multiple interactions ISO Trpm3 (Mus musculus) 6480464 pregnenolone sulfate binds to and results in increased activity of TRPM3 protein CTD PMID:30883612 Trpm3 Rat propanal decreases expression ISO TRPM3 (Homo sapiens) 6480464 propionaldehyde results in decreased expression of TRPM3 mRNA CTD PMID:26079696 Trpm3 Rat pyridaben increases expression ISO Trpm3 (Mus musculus) 6480464 pyridaben results in increased expression of TRPM3 mRNA CTD PMID:22563483 Trpm3 Rat sarin increases expression ISO TRPM3 (Homo sapiens) 6480464 Sarin results in increased expression of TRPM3 mRNA CTD PMID:19522546 Trpm3 Rat SB 431542 multiple interactions ISO TRPM3 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Trpm3 Rat sodium arsenite affects expression ISO TRPM3 (Homo sapiens) 6480464 sodium arsenite affects the expression of TRPM3 mRNA CTD PMID:29301061 Trpm3 Rat sodium arsenite decreases expression ISO Trpm3 (Mus musculus) 6480464 sodium arsenite results in decreased expression of TRPM3 mRNA CTD PMID:36209798 Trpm3 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of TRPM3 mRNA CTD PMID:30047161 Trpm3 Rat thimerosal increases expression ISO TRPM3 (Homo sapiens) 6480464 Thimerosal results in increased expression of TRPM3 mRNA CTD PMID:27188386 Trpm3 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of TRPM3 mRNA CTD PMID:34492290 Trpm3 Rat titanium dioxide increases methylation ISO Trpm3 (Mus musculus) 6480464 titanium dioxide results in increased methylation of TRPM3 promoter CTD PMID:35295148 Trpm3 Rat titanium dioxide decreases methylation ISO Trpm3 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of TRPM3 gene CTD PMID:35295148 Trpm3 Rat trichostatin A decreases expression ISO TRPM3 (Homo sapiens) 6480464 trichostatin A results in decreased expression of TRPM3 mRNA CTD PMID:24935251 Trpm3 Rat trichostatin A increases expression ISO TRPM3 (Homo sapiens) 6480464 trichostatin A results in increased expression of TRPM3 mRNA CTD PMID:24935251 Trpm3 Rat triptonide increases expression ISO Trpm3 (Mus musculus) 6480464 triptonide results in increased expression of TRPM3 mRNA CTD PMID:33045310 Trpm3 Rat valproic acid decreases expression ISO Trpm3 (Mus musculus) 6480464 Valproic Acid results in decreased expression of TRPM3 mRNA CTD PMID:24896083 Trpm3 Rat valproic acid affects splicing EXP 6480464 Valproic Acid affects the splicing of TRPM3 mRNA CTD PMID:29427782 Trpm3 Rat valproic acid increases expression ISO TRPM3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of TRPM3 mRNA CTD PMID:23179753 and PMID:27188386 Trpm3 Rat valproic acid multiple interactions ISO TRPM3 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of TRPM3 mRNA CTD PMID:27188386 Trpm3 Rat valproic acid decreases expression ISO TRPM3 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of TRPM3 mRNA CTD PMID:23179753 more ... Trpm3 Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of TRPM3 gene CTD PMID:31682807 Trpm3 Rat vorinostat multiple interactions ISO TRPM3 (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TRPM3 mRNA CTD PMID:27188386 Trpm3 Rat vorinostat increases expression ISO TRPM3 (Homo sapiens) 6480464 vorinostat results in increased expression of TRPM3 mRNA CTD PMID:26272509 Trpm3 Rat zinc atom increases expression ISO TRPM3 (Homo sapiens) 6480464 Zinc deficiency results in increased expression of TRPM3 mRNA CTD PMID:22171008 Trpm3 Rat zinc(0) increases expression ISO TRPM3 (Homo sapiens) 6480464 Zinc deficiency results in increased expression of TRPM3 mRNA CTD PMID:22171008
1,2-dichloroethane (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) amitrole (EXP) amphotericin B (ISO) antirheumatic drug (ISO) arsenous acid (ISO) atrazine (EXP) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bromobenzene (EXP) carbamazepine (ISO) CGP 52608 (ISO) chlordecone (ISO) Cuprizon (EXP) cyclosporin A (ISO) diarsenic trioxide (ISO) dorsomorphin (ISO) doxorubicin (EXP) endosulfan (EXP) entinostat (ISO) ethanol (ISO) fulvestrant (ISO) genistein (ISO) glyphosate (EXP) liquiritigenin (ISO) maneb (ISO) methamphetamine (ISO) methoxychlor (EXP) methylmercury chloride (ISO) mono(2-ethylhexyl) phthalate (ISO) paracetamol (EXP,ISO) paraquat (ISO) pregnenolone sulfate (ISO) propanal (ISO) pyridaben (ISO) sarin (ISO) SB 431542 (ISO) sodium arsenite (ISO) sulfadimethoxine (EXP) thimerosal (ISO) thioacetamide (EXP) titanium dioxide (ISO) trichostatin A (ISO) triptonide (ISO) valproic acid (EXP,ISO) vinclozolin (EXP) vorinostat (ISO) zinc atom (ISO) zinc(0) (ISO)
Trpm3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 229,099,741 - 229,984,172 (+) NCBI GRCr8 mRatBN7.2 1 219,673,200 - 220,557,610 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 219,672,892 - 220,560,717 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 228,126,334 - 228,996,882 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 235,056,436 - 235,926,937 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 227,874,450 - 228,744,986 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 239,741,572 - 240,757,583 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 240,355,149 - 240,757,583 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 247,027,120 - 247,810,732 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 1 247,942,661 - 248,041,913 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 225,377,097 - 226,276,992 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 225,865,833 - 226,439,441 (+) NCBI Celera 1 216,900,275 - 217,774,744 (+) NCBI Celera Cytogenetic Map 1 q51 NCBI
TRPM3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 70,529,060 - 71,446,971 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 70,529,060 - 71,446,977 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 73,143,976 - 74,061,887 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 72,339,769 - 72,926,334 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 9 43,740,296 - 44,308,807 (-) NCBI Celera Cytogenetic Map 9 q21.12-q21.13 NCBI HuRef 9 42,990,124 - 43,559,409 (-) NCBI HuRef CHM1_1 9 73,296,608 - 73,882,917 (-) NCBI CHM1_1 T2T-CHM13v2.0 9 82,695,847 - 83,597,417 (-) NCBI T2T-CHM13v2.0
Trpm3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 22,114,789 - 22,972,774 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 22,116,410 - 22,972,774 (+) Ensembl GRCm39 Ensembl GRCm38 19 22,137,797 - 22,995,410 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 22,139,046 - 22,995,410 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 22,213,607 - 23,064,374 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 22,206,214 - 23,056,981 (+) NCBI MGSCv36 mm8 Celera 19 22,863,961 - 23,712,483 (+) NCBI Celera Cytogenetic Map 19 B NCBI cM Map 19 16.05 NCBI
Trpm3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955434 1,725,692 - 2,542,077 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955434 2,017,809 - 2,543,827 (+) NCBI ChiLan1.0 ChiLan1.0
TRPM3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 69,729,091 - 70,634,552 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 69,735,031 - 70,640,633 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 53,367,505 - 54,272,917 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 69,286,220 - 70,189,177 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 69,292,593 - 69,606,949 (-) Ensembl panpan1.1 panPan2
TRPM3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 86,525,054 - 87,023,561 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 86,242,487 - 87,017,292 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 86,997,042 - 87,495,355 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 86,977,918 - 87,572,008 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 86,695,268 - 87,570,615 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 86,738,803 - 87,230,190 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 86,444,184 - 86,935,800 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 87,201,388 - 87,693,419 (+) NCBI UU_Cfam_GSD_1.0
Trpm3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 133,674,904 - 134,486,513 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936503 6,690,043 - 7,497,963 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936503 6,688,476 - 7,188,417 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TRPM3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 223,836,213 - 224,680,389 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 223,833,263 - 224,682,424 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 250,297,464 - 250,831,887 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TRPM3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 81,608,301 - 82,616,349 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 81,609,229 - 81,925,984 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 70,019,264 - 70,927,870 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Trpm3
.
Predicted Target Of
Count of predictions: 651 Count of miRNA genes: 292 Interacting mature miRNAs: 372 Transcripts: ENSRNOT00000018521 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
8693637 Alc29 Alcohol consumption QTL 29 2.7 0.258 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 1 207987464 234238494 Rat 1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1357335 Bw39 Body weight QTL 39 3.3 body mass (VT:0001259) body weight (CMO:0000012) 1 197814409 242814409 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 2302375 Bw83 Body weight QTL 83 4.87 0.0002 body mass (VT:0001259) body weight (CMO:0000012) 1 197697768 242697768 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2293674 Bss39 Bone structure and strength QTL 39 7.1 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 1 201554356 246554356 Rat 5508828 Leukc3 Leukocyte quantity QTL 3 eosinophil quantity (VT:0002602) blood eosinophil count (CMO:0000033) 1 218108584 224054420 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 61455 Niddm7 Non-insulin dependent diabetes mellitus QTL 7 5.5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 214537555 238757011 Rat 61327 Eae7 Experimental allergic encephalomyelitis QTL 7 5.6 body mass (VT:0001259) change in body weight (CMO:0002045) 1 216255568 260522016 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1558658 Bw59 Body weight QTL 59 3.5 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 1 178784622 223784622 Rat 1600397 Edcs4 Endometrial carcinoma susceptibility QTL 4 2.2 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 1 206081677 251081677 Rat 631838 Niddm36 Non-insulin dependent diabetes mellitus QTL 36 0.01 insulin secretion trait (VT:0003564) calculated pancreatic islet insulin release measurement (CMO:0001217) 1 184550676 229550676 Rat 8693661 Alc34 Alcohol consumption QTL 34 2.2 0.611 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 1 207987464 228627600 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 2293694 Bss38 Bone structure and strength QTL 38 7.05 0.0001 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 1 201554356 246554356 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 1300145 Rf7 Renal function QTL 7 2.96 urine creatinine amount (VT:0010540) urine creatinine level (CMO:0000125) 1 185145134 221264292 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 2300175 Bmd40 Bone mineral density QTL 40 15.4 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 1 201554356 246554356 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 724538 Kidm1 Kidney mass QTL 1 3.2 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 213707201 252085212 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 737977 Bp160 Blood pressure QTL 160 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 181133855 226133855 Rat 2293655 Bss36 Bone structure and strength QTL 36 10.66 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 201554356 246554356 Rat 1298084 Thym4 Thymus enlargement QTL 4 10.68 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 197814409 242814409 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 8552891 Epfw5 Epididymal fat weight QTL 5 4.4 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 1 193113876 238113876 Rat 734768 Niddm59 Non-insulin dependent diabetes mellitus QTL 59 body mass (VT:0001259) body weight (CMO:0000012) 1 213843987 258843987 Rat 1358890 Bp259 Blood pressure QTL 259 3.06 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 210702053 260522016 Rat 724533 Rf51 Renal function QTL 51 5.3 0.0002 kidney plasma flow trait (VT:0005524) renal plasma flow (CMO:0001914) 1 218753816 256448513 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358292 Cm37 Cardiac mass QTL 37 6.2 8e-07 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 1 196248093 241248093 Rat 61376 Bp42 Blood pressure QTL 42 23.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 197814409 242814409 Rat 634313 Niddm43 Non-insulin dependent diabetes mellitus QTL 43 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 199050459 259647894 Rat 634312 Bp143 Blood pressure QTL 143 3 0.0002 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 182623426 219932796 Rat 1549910 Bw54 Body weight QTL 54 0.05 body mass (VT:0001259) body weight (CMO:0000012) 1 214647894 259647894 Rat 70211 Niddm24 Non-insulin dependent diabetes mellitus QTL 24 3.79 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 214647894 259647894 Rat 1357399 Bw45 Body weight QTL 45 3.05 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 1 206329708 251329708 Rat 1357404 Bw42 Body weight QTL 42 4.49 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 1 206329708 251329708 Rat 10059600 Bp378 Blood pressure QTL 378 3.08 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 176869060 221869060 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 1358916 Kidm22 Kidney mass QTL 22 3.32 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 210702053 240947965 Rat 2312564 Glom18 Glomerulus QTL 18 2.4 0.003 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 185356336 231689108 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 2292218 Kidm35 Kidney mass QTL 35 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 199368955 224569684 Rat 61400 Niddm1 Non-insulin dependent diabetes mellitus QTL 1 11 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 218753689 245907899 Rat 1331790 Bp201 Blood pressure QTL 201 3.127 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 198211513 225126682 Rat 10059587 Bw173 Body weight QTL 173 3.23 0.025 body mass (VT:0001259) body weight (CMO:0000012) 1 202069611 247069611 Rat 2292216 Bw80 Body weight QTL 80 3.23 0.0019 body mass (VT:0001259) body weight (CMO:0000012) 1 213533809 243914901 Rat 61403 Niddm4 Non-insulin dependent diabetes mellitus QTL 4 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 206329708 222745518 Rat 1300168 Bp170 Blood pressure QTL 170 2.76 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 207702246 228581766 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 10059590 Kidm44 Kidney mass QTL 44 3.42 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 191033875 236033875 Rat 1641926 Teswt2 Testicular weight QTL 2 2.82 testis mass (VT:1000644) both testes wet weight (CMO:0000175) 1 197697768 238755659 Rat 631658 Cm7 Cardiac mass QTL 7 5.32 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 1 196248093 241248093 Rat 1600380 Niddm70 Non-insulin dependent diabetes mellitus QTL 70 3.1 0.0008 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 176550523 221550523 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1582206 Kidm33 Kidney mass QTL 33 6.9 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 188377360 224054420 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 634340 Hcar5 Hepatocarcinoma resistance QTL 5 8 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 214537555 226660468 Rat 1600374 Mcs17 Mammary carcinoma susceptibility QTL 17 3 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 197670404 242670404 Rat 1600363 Hc6 Hypercalciuria QTL 6 2.7 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 203995416 244113296 Rat 8693618 Alc25 Alcohol consumption QTL 25 3 0.28 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 1 207987464 228627600 Rat 2293083 Iddm25 Insulin dependent diabetes mellitus QTL 25 4.18 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 181829673 224569684 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 2302040 Pia35 Pristane induced arthritis QTL 35 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 216255568 260522016 Rat 7394701 Uae46 Urinary albumin excretion QTL 46 3.6 0.0056 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 201554356 246554356 Rat 1598821 Rf55 Renal function QTL 55 6.3 renal blood flow trait (VT:2000006) ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239) 1 218748008 257976495 Rat
D1Rat298
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 1 229,359,117 - 229,359,342 (+) Marker Load Pipeline mRatBN7.2 1 219,932,573 - 219,932,796 (+) MAPPER mRatBN7.2 Rnor_6.0 1 240,017,117 - 240,017,341 NCBI Rnor6.0 Rnor_5.0 1 247,303,036 - 247,303,260 UniSTS Rnor5.0 RGSC_v3.4 1 225,625,031 - 225,625,256 RGD RGSC3.4 RGSC_v3.4 1 225,625,032 - 225,625,256 UniSTS RGSC3.4 RGSC_v3.1 1 225,789,054 - 225,789,279 RGD Celera 1 217,158,892 - 217,159,116 UniSTS SHRSP x BN Map 1 116.5799 UniSTS SHRSP x BN Map 1 116.5799 RGD Cytogenetic Map 1 q51 UniSTS
D1Rat370
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 1 229,592,115 - 229,592,339 (+) Marker Load Pipeline mRatBN7.2 1 220,165,574 - 220,165,798 (+) MAPPER mRatBN7.2 Rnor_6.0 1 240,251,616 - 240,251,839 NCBI Rnor6.0 Rnor_5.0 1 247,538,736 - 247,538,959 UniSTS Rnor5.0 RGSC_v3.4 1 225,860,708 - 225,860,932 RGD RGSC3.4 RGSC_v3.4 1 225,860,709 - 225,860,932 UniSTS RGSC3.4 RGSC_v3.1 1 226,024,731 - 226,024,955 RGD Celera 1 217,385,744 - 217,385,967 UniSTS SHRSP x BN Map 1 116.5799 UniSTS SHRSP x BN Map 1 116.5799 RGD Cytogenetic Map 1 q51 UniSTS
D1Rat369
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 1 229,887,667 - 229,887,924 (+) Marker Load Pipeline mRatBN7.2 1 220,461,115 - 220,461,370 (+) MAPPER mRatBN7.2 Rnor_6.0 1 240,660,288 - 240,660,546 NCBI Rnor6.0 Rnor_5.0 1 247,946,430 - 247,946,688 UniSTS Rnor5.0 RGSC_v3.4 1 226,179,791 - 226,180,047 RGD RGSC3.4 RGSC_v3.4 1 226,179,792 - 226,180,048 UniSTS RGSC3.4 RGSC_v3.1 1 226,343,814 - 226,344,070 RGD Celera 1 217,677,579 - 217,677,821 UniSTS SHRSP x BN Map 1 116.5799 UniSTS SHRSP x BN Map 1 116.5799 RGD Cytogenetic Map 1 q51 UniSTS
D19Ertd744e
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 220,551,196 - 220,551,416 (+) MAPPER mRatBN7.2 Rnor_6.0 1 240,751,174 - 240,751,393 NCBI Rnor6.0 Rnor_5.0 1 248,035,504 - 248,035,723 UniSTS Rnor5.0 RGSC_v3.4 1 226,270,583 - 226,270,802 UniSTS RGSC3.4 Celera 1 217,768,335 - 217,768,554 UniSTS Cytogenetic Map 1 q51 UniSTS
RH144107
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 220,556,140 - 220,556,311 (+) MAPPER mRatBN7.2 Rnor_6.0 1 240,756,114 - 240,756,284 NCBI Rnor6.0 Rnor_5.0 1 248,040,444 - 248,040,614 UniSTS Rnor5.0 RGSC_v3.4 1 226,275,523 - 226,275,693 UniSTS RGSC3.4 Celera 1 217,773,275 - 217,773,445 UniSTS RH 3.4 Map 1 1615.31 UniSTS Cytogenetic Map 1 q51 UniSTS
BE102851
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 220,488,174 - 220,488,366 (+) MAPPER mRatBN7.2 Rnor_6.0 1 240,687,347 - 240,687,538 NCBI Rnor6.0 Rnor_5.0 1 247,973,370 - 247,973,561 UniSTS Rnor5.0 RGSC_v3.4 1 226,206,867 - 226,207,058 UniSTS RGSC3.4 Celera 1 217,704,852 - 217,705,043 UniSTS RH 3.4 Map 1 1614.3 UniSTS Cytogenetic Map 1 q51 UniSTS
BE107788
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 220,127,904 - 220,128,108 (+) MAPPER mRatBN7.2 Rnor_6.0 1 240,214,177 - 240,214,380 NCBI Rnor6.0 Rnor_5.0 1 247,501,219 - 247,501,422 UniSTS Rnor5.0 RGSC_v3.4 1 225,820,965 - 225,821,168 UniSTS RGSC3.4 Celera 1 217,347,814 - 217,348,017 UniSTS RH 3.4 Map 1 1615.2 UniSTS Cytogenetic Map 1 q51 UniSTS
BE108061
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 220,051,657 - 220,051,840 (+) MAPPER mRatBN7.2 Rnor_6.0 1 240,133,150 - 240,133,332 NCBI Rnor6.0 Rnor_5.0 1 247,420,108 - 247,420,290 UniSTS Rnor5.0 RGSC_v3.4 1 225,745,103 - 225,745,285 UniSTS RGSC3.4 Celera 1 217,271,340 - 217,271,522 UniSTS RH 3.4 Map 1 1617.5 UniSTS Cytogenetic Map 1 q51 UniSTS
BF405786
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 220,121,237 - 220,121,422 (+) MAPPER mRatBN7.2 Rnor_6.0 1 240,207,089 - 240,207,273 NCBI Rnor6.0 Rnor_5.0 1 247,494,047 - 247,494,231 UniSTS Rnor5.0 RGSC_v3.4 1 225,814,121 - 225,814,305 UniSTS RGSC3.4 Celera 1 217,341,142 - 217,341,326 UniSTS RH 3.4 Map 1 1614.9 UniSTS Cytogenetic Map 1 q51 UniSTS
RH135031
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 220,337,603 - 220,337,784 (+) MAPPER mRatBN7.2 Rnor_6.0 1 240,423,678 - 240,423,858 NCBI Rnor6.0 Rnor_5.0 1 247,710,868 - 247,711,048 UniSTS Rnor5.0 RGSC_v3.4 1 226,033,672 - 226,033,852 UniSTS RGSC3.4 Celera 1 217,555,078 - 217,555,258 UniSTS RH 3.4 Map 1 1615.51 UniSTS Cytogenetic Map 1 q51 UniSTS
RH135304
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 219,811,320 - 219,811,525 (+) MAPPER mRatBN7.2 Rnor_6.0 1 239,881,284 - 239,881,488 NCBI Rnor6.0 Rnor_5.0 1 247,166,315 - 247,166,519 UniSTS Rnor5.0 RGSC_v3.4 1 225,503,160 - 225,503,364 UniSTS RGSC3.4 Celera 1 217,037,876 - 217,038,100 UniSTS Cytogenetic Map 1 q51 UniSTS
BF415773
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 220,144,561 - 220,144,692 (+) MAPPER mRatBN7.2 Rnor_6.0 1 240,230,832 - 240,230,962 NCBI Rnor6.0 Rnor_5.0 1 247,517,874 - 247,518,004 UniSTS Rnor5.0 RGSC_v3.4 1 225,837,620 - 225,837,750 UniSTS RGSC3.4 Celera 1 217,364,469 - 217,364,599 UniSTS RH 3.4 Map 1 1617.32 UniSTS Cytogenetic Map 1 q51 UniSTS
BF416487
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 220,472,338 - 220,472,485 (+) MAPPER mRatBN7.2 Rnor_6.0 1 240,671,511 - 240,671,657 NCBI Rnor6.0 Rnor_5.0 1 247,957,534 - 247,957,680 UniSTS Rnor5.0 RGSC_v3.4 1 226,191,031 - 226,191,177 UniSTS RGSC3.4 Celera 1 217,689,016 - 217,689,162 UniSTS RH 3.4 Map 1 1615.92 UniSTS Cytogenetic Map 1 q51 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
41
113
60
59
28
25
28
6
179
89
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000018521 ⟹ ENSRNOP00000018521
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 220,008,655 - 220,557,610 (+) Ensembl Rnor_6.0 Ensembl 1 240,355,149 - 240,757,583 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000098066 ⟹ ENSRNOP00000081604
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 220,008,970 - 220,342,837 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000109194 ⟹ ENSRNOP00000084148
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 219,672,892 - 220,557,610 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000113385 ⟹ ENSRNOP00000083902
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 219,672,892 - 220,557,610 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000114759 ⟹ ENSRNOP00000084016
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 220,008,655 - 220,560,717 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000114800 ⟹ ENSRNOP00000093587
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 220,008,655 - 220,557,610 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000115994 ⟹ ENSRNOP00000094201
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 220,008,970 - 220,341,856 (+) Ensembl
RefSeq Acc Id:
NM_001191562 ⟹ NP_001178491
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 229,099,741 - 229,984,172 (+) NCBI mRatBN7.2 1 219,673,200 - 220,557,610 (+) NCBI Rnor_6.0 1 239,741,572 - 240,757,583 (+) NCBI Rnor_5.0 1 247,027,120 - 247,810,732 (+) NCBI Rnor_5.0 1 247,942,661 - 248,041,913 (+) NCBI Celera 1 216,900,275 - 217,774,744 (+) NCBI
Sequence:
ATGGGCAAGAAGTGGAGGGACGCGGGCGAGATGGAGCGAGGCTGCTCTGATCGCGAGGGCAGCGCGGAGAGCCGCCGGCGCAGCCGCAGCGCCAGCCGGGGCAGGTTTGCCGAGTCGTGGAAAAGGTT
hide sequence
RefSeq Acc Id:
NM_001354180 ⟹ NP_001341109
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 229,435,510 - 229,984,172 (+) NCBI mRatBN7.2 1 220,008,970 - 220,557,610 (+) NCBI
RefSeq Acc Id:
NP_001178491 ⟸ NM_001191562
- Peptide Label:
isoform a
- UniProtKB:
A0A8I6A0P1 (UniProtKB/TrEMBL)
- Sequence:
MGKKWRDAGEMERGCSDREGSAESRRRSRSASRGRFAESWKRLSSKQGSTKRSGLPAQQTPAQKSWIERAFYKRECVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWS
hide sequence
Ensembl Acc Id:
ENSRNOP00000018521 ⟸ ENSRNOT00000018521
RefSeq Acc Id:
NP_001341109 ⟸ NM_001354180
- Peptide Label:
isoform b
- UniProtKB:
F1LN45 (UniProtKB/TrEMBL), A0A8I6ALW5 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000083902 ⟸ ENSRNOT00000113385
Ensembl Acc Id:
ENSRNOP00000084148 ⟸ ENSRNOT00000109194
Ensembl Acc Id:
ENSRNOP00000094201 ⟸ ENSRNOT00000115994
Ensembl Acc Id:
ENSRNOP00000081604 ⟸ ENSRNOT00000098066
Ensembl Acc Id:
ENSRNOP00000093587 ⟸ ENSRNOT00000114800
Ensembl Acc Id:
ENSRNOP00000084016 ⟸ ENSRNOT00000114759
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Trpm3
transient receptor potential cation channel, subfamily M, member 3
Trpm3_predicted
transient receptor potential cation channel, subfamily M, member 3 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Trpm3_predicted
transient receptor potential cation channel, subfamily M, member 3 (predicted)
Symbol and Name status set to approved
70820 APPROVED
