Advanced Search (OLGA)

Gene: Tfap2d (transcription factor AP-2 delta) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Tfap2d

Name:

transcription factor AP-2 delta

RGD ID:

1304864

Description:

Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II transcription regulatory region sequence-specific DNA binding activity. Predicted to act upstream of or within inferior colliculus development; negative regulation of neuron apoptotic process; and positive regulation of transcription by RNA polymerase II. Predicted to be located in nucleus. Predicted to be part of transcription regulator complex. Orthologous to human TFAP2D (transcription factor AP-2 delta); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC301284; Tcfap2d; transcription factor AP-2, delta; transcription factor AP-2-delta

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	29,177,096 - 29,241,412 (+)	NCBI		GRCr8
mRatBN7.2	9	21,680,577 - 21,744,840 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	21,680,577 - 21,740,728 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	30,165,099 - 30,223,175 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	35,311,336 - 35,369,776 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	33,607,510 - 33,665,582 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	25,304,876 - 25,365,151 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	25,304,876 - 25,365,151 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	24,167,386 - 24,227,643 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	17,936,724 - 18,006,941 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	17,933,765 - 18,004,235 (+)	NCBI
Celera	9	19,269,921 - 19,328,727 (+)	NCBI		Celera
Cytogenetic Map	9	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tfap2d	Rat	2,2',4,4'-Tetrabromodiphenyl ether	increases expression	EXP		6480464	2 more ...	CTD	PMID:21394737
Tfap2d	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Tfap2d (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of TFAP2D mRNA	CTD	PMID:24058054
Tfap2d	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of TFAP2D mRNA	CTD	PMID:32109520
Tfap2d	Rat	2,3,7,8-Tetrachlorodibenzofuran	decreases expression	EXP		6480464	2 more ...	CTD	PMID:32109520
Tfap2d	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	Tfap2d (Mus musculus)	6480464	bisphenol S results in decreased expression of TFAP2D mRNA	CTD	PMID:30951980
Tfap2d	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of TFAP2D mRNA	CTD	PMID:24780913
Tfap2d	Rat	aflatoxin B1	decreases methylation	ISO	TFAP2D (Homo sapiens)	6480464	Aflatoxin B1 results in decreased methylation of TFAP2D gene	CTD	PMID:27153756
Tfap2d	Rat	arsenite(3-)	increases methylation	ISO	TFAP2D (Homo sapiens)	6480464	arsenite results in increased methylation of TFAP2D promoter	CTD	PMID:23974009
Tfap2d	Rat	benzo[a]pyrene	increases methylation	ISO	TFAP2D (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of TFAP2D promoter	CTD	PMID:27901495
Tfap2d	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of TFAP2D mRNA	CTD	PMID:25181051 more ...
Tfap2d	Rat	bisphenol A	multiple interactions	ISO	TFAP2D (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in increased methylation of TFAP2D gene	CTD	PMID:31601247
Tfap2d	Rat	bisphenol A	decreases expression	ISO	Tfap2d (Mus musculus)	6480464	bisphenol A results in decreased expression of TFAP2D mRNA	CTD	PMID:30951980
Tfap2d	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of TFAP2D mRNA	CTD	PMID:30816183 and PMID:32528016
Tfap2d	Rat	bisphenol A	affects methylation	ISO	Tfap2d (Mus musculus)	6480464	bisphenol A affects the methylation of TFAP2D promoter	CTD	PMID:27334623
Tfap2d	Rat	bisphenol F	decreases expression	ISO	Tfap2d (Mus musculus)	6480464	bisphenol F results in decreased expression of TFAP2D mRNA	CTD	PMID:30951980
Tfap2d	Rat	dibutyl phthalate	decreases expression	ISO	Tfap2d (Mus musculus)	6480464	Dibutyl Phthalate results in decreased expression of TFAP2D mRNA	CTD	PMID:31841868
Tfap2d	Rat	fulvestrant	decreases methylation	ISO	TFAP2D (Homo sapiens)	6480464	Fulvestrant results in decreased methylation of TFAP2D gene	CTD	PMID:31601247
Tfap2d	Rat	fulvestrant	multiple interactions	ISO	TFAP2D (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in increased methylation of TFAP2D gene	CTD	PMID:31601247
Tfap2d	Rat	ketamine	decreases expression	EXP		6480464	Ketamine results in decreased expression of TFAP2D mRNA	CTD	PMID:20080153
Tfap2d	Rat	lead diacetate	increases methylation	EXP		6480464	lead acetate results in increased methylation of TFAP2D gene	CTD	PMID:29571894
Tfap2d	Rat	N,N-diethyl-m-toluamide	multiple interactions	EXP		6480464	[Permethrin co-treated with DEET] results in decreased methylation of TFAP2D gene	CTD	PMID:33148267
Tfap2d	Rat	permethrin	multiple interactions	EXP		6480464	[Permethrin co-treated with DEET] results in decreased methylation of TFAP2D gene	CTD	PMID:33148267
Tfap2d	Rat	silicon dioxide	decreases expression	ISO	TFAP2D (Homo sapiens)	6480464	Silicon Dioxide analog results in decreased expression of TFAP2D mRNA	CTD	PMID:25895662
Tfap2d	Rat	sodium arsenite	decreases methylation	ISO	Tfap2d (Mus musculus)	6480464	sodium arsenite results in decreased methylation of TFAP2D gene	CTD	PMID:32068019
Tfap2d	Rat	valproic acid	decreases expression	ISO	Tfap2d (Mus musculus)	6480464	Valproic Acid results in decreased expression of TFAP2D mRNA	CTD	PMID:24896083

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tfap2d	Rat	inferior colliculus development	acts_upstream_of_or_within	IEA	UniProtKB:Q91ZK0 and ensembl:ENSMUSP00000037699	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tfap2d	Rat	inferior colliculus development	acts_upstream_of_or_within	ISO	Tfap2d (Mus musculus)	1624291	MGI:5296818 PMID:21858141	RGD	PMID:21858141
Tfap2d	Rat	negative regulation of neuron apoptotic process	acts_upstream_of_or_within	ISO	Tfap2d (Mus musculus)	1624291	MGI:5296818 PMID:21858141	RGD	PMID:21858141
Tfap2d	Rat	negative regulation of neuron apoptotic process	acts_upstream_of_or_within	IEA	UniProtKB:Q91ZK0 and ensembl:ENSMUSP00000037699	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tfap2d	Rat	positive regulation of DNA-templated transcription	acts_upstream_of_or_within	ISO	Tfap2d (Mus musculus)	1624291	PMID:11522791	RGD	PMID:11522791
Tfap2d	Rat	positive regulation of DNA-templated transcription	acts_upstream_of_or_within	IEA	UniProtKB:Q91ZK0 and ensembl:ENSMUSP00000037699	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tfap2d	Rat	positive regulation of transcription by RNA polymerase II	acts_upstream_of_or_within	IEA	UniProtKB:Q91ZK0 and ensembl:ENSMUSP00000037699	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tfap2d	Rat	positive regulation of transcription by RNA polymerase II	involved_in	IEA	ARBA:ARBA00027996	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Tfap2d	Rat	positive regulation of transcription by RNA polymerase II	acts_upstream_of_or_within	ISO	Tfap2d (Mus musculus)	1624291	PMID:21858141	RGD	PMID:21858141
Tfap2d	Rat	regulation of DNA-templated transcription	involved_in	IEA	InterPro:IPR004979	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Tfap2d	Rat	transcription by RNA polymerase II	acts_upstream_of	ISO	Tfap2d (Mus musculus)	1624291	PMID:21858141	RGD	PMID:21858141
Tfap2d	Rat	transcription by RNA polymerase II	acts_upstream_of	IEA	UniProtKB:Q91ZK0 and ensembl:ENSMUSP00000037699	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tfap2d	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Tfap2d	Rat	nucleus	located_in	IEA	InterPro:IPR004979	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Tfap2d	Rat	transcription regulator complex	part_of	IEA	UniProtKB:Q91ZK0 and ensembl:ENSMUSP00000037699	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tfap2d	Rat	transcription regulator complex	part_of	ISO	Tfap2d (Mus musculus)	1624291	PR:P34056 PMID:11522791	RGD	PMID:11522791

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tfap2d	Rat	DNA binding	enables	IEA	UniProtKB-KW:KW-0238	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tfap2d	Rat	DNA-binding transcription factor activity	enables	IEA	InterPro:IPR004979	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Tfap2d	Rat	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	ISO	Tfap2d (Mus musculus)	1624291	MGI:5296818 PMID:21858141	RGD	PMID:21858141
Tfap2d	Rat	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	IEA	UniProtKB:Q91ZK0 and ensembl:ENSMUSP00000037699	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tfap2d	Rat	protein binding	enables	ISO	TFAP2D (Homo sapiens)	1624291	UniProtKB:A0A0C4DGF1 more ...	RGD	PMID:32296183
Tfap2d	Rat	protein binding	enables	ISO	Tfap2d (Mus musculus)	1624291	PR:P34056 more ...	RGD	PMID:11522791 and PMID:18495928
Tfap2d	Rat	RNA polymerase II transcription regulatory region sequence-specific DNA binding	enables	ISO	Tfap2d (Mus musculus)	1624291	PMID:21858141	RGD	PMID:21858141
Tfap2d	Rat	RNA polymerase II transcription regulatory region sequence-specific DNA binding	enables	IEA	UniProtKB:Q91ZK0 and ensembl:ENSMUSP00000037699	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:11522791	PMID:21858141

Tfap2d
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	29,177,096 - 29,241,412 (+)	NCBI		GRCr8
mRatBN7.2	9	21,680,577 - 21,744,840 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	21,680,577 - 21,740,728 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	30,165,099 - 30,223,175 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	35,311,336 - 35,369,776 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	33,607,510 - 33,665,582 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	25,304,876 - 25,365,151 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	25,304,876 - 25,365,151 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	24,167,386 - 24,227,643 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	17,936,724 - 18,006,941 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	17,933,765 - 18,004,235 (+)	NCBI
Celera	9	19,269,921 - 19,328,727 (+)	NCBI		Celera
Cytogenetic Map	9	q13	NCBI

TFAP2D
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	50,713,526 - 50,773,033 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	50,713,526 - 50,773,033 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	50,681,239 - 50,740,746 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	50,789,216 - 50,848,705 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	50,789,215 - 50,848,705	NCBI
Celera	6	52,237,300 - 52,296,828 (+)	NCBI		Celera
Cytogenetic Map	6	p12.3	NCBI
HuRef	6	50,413,057 - 50,472,532 (+)	NCBI		HuRef
CHM1_1	6	50,684,197 - 50,743,722 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	50,556,563 - 50,616,124 (+)	NCBI		T2T-CHM13v2.0

Tfap2d
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	19,173,246 - 19,244,172 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	19,173,246 - 19,236,570 (+)	Ensembl		GRCm39 Ensembl
GRCm38	1	19,103,022 - 19,173,948 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	19,103,022 - 19,166,346 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	19,093,103 - 19,156,419 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	19,088,238 - 19,151,552 (+)	NCBI		MGSCv36	mm8
Celera	1	18,998,088 - 19,060,944 (+)	NCBI		Celera
Cytogenetic Map	1	A3	NCBI
cM Map	1	6.08	NCBI

Tfap2d
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955411	7,216,832 - 7,276,356 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955411	7,219,474 - 7,276,350 (-)	NCBI	ChiLan1.0	ChiLan1.0

TFAP2D
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	65,188,390 - 65,248,031 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	61,053,645 - 61,113,268 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	50,274,808 - 50,332,788 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	51,531,757 - 51,590,888 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	51,531,757 - 51,590,888 (+)	Ensembl	panpan1.1		panPan2

TFAP2D
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	18,447,086 - 18,504,137 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	18,447,105 - 18,504,142 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	18,339,916 - 18,396,664 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	18,944,513 - 19,001,109 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	18,944,275 - 19,001,114 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	18,453,196 - 18,509,808 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	18,557,245 - 18,613,864 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	18,694,770 - 18,751,403 (+)	NCBI		UU_Cfam_GSD_1.0

Tfap2d
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	53,970,148 - 54,027,942 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936476	9,932,156 - 9,990,037 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936476	9,933,247 - 9,996,375 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TFAP2D
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	44,640,281 - 44,703,562 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	44,640,281 - 44,702,561 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	50,994,878 - 51,057,262 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TFAP2D
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	21,671,570 - 21,733,003 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	21,671,752 - 21,727,772 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666044	50,660,481 - 50,717,179 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tfap2d
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624855	5,431,715 - 5,491,952 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624855	5,430,283 - 5,491,961 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Tfap2d
454 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	32
Count of miRNA genes:	25
Interacting mature miRNAs:	32
Transcripts:	ENSRNOT00000065053
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631211	Bw4	Body weight QTL4	5.31		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	9	5109826	50109826	Rat
2303559	Gluco54	Glucose level QTL 54	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	9	1254084	46254084	Rat
7411609	Foco16	Food consumption QTL 16	25.6	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	8952560	53952560	Rat
631680	Cm11	Cardiac mass QTL 11	3.1	0.00089	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	9	20430519	65430519	Rat
61450	Ciaa3	CIA Autoantibody QTL 3	6.5		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	9	7954720	22071169	Rat
9589055	Scfw5	Subcutaneous fat weight QTL 5	5.55	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	9	1	37999212	Rat
1641911	Alcrsp13	Alcohol response QTL 13			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	9	1	43718459	Rat
1354650	Despr5	Despair related QTL 5	4.01	0.0017	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	9	1254084	46254084	Rat
1300124	Cm4	Cardiac mass QTL 4	3.55		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	9	1	40594091	Rat
61425	Cia15	Collagen induced arthritis QTL 15	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	9	5109826	42921101	Rat
70226	Eae4	Experimental allergic encephalomyelitis QTL 4			nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	9	1	25661317	Rat
9589158	Gluco65	Glucose level QTL 65	6.82	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	9	1	37999212	Rat
10054125	Srcrt7	Stress Responsive Cort QTL 7	3.33	0.0011	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	9	1	87073594	Rat
724543	Cm20	Cardiac mass QTL 20	3.9		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	9	16961398	40594091	Rat
1600365	Mcs20	Mammary carcinoma susceptibility QTL 20	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	9	13533770	42791750	Rat
11353947	Bp392	Blood pressure QTL 392			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	7283252	52283252	Rat
7411592	Foco8	Food consumption QTL 8	7.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	1	37999212	Rat
1331757	Cdexp1	CD45RC expression in CD8 T cells QTL 1	4.3		CD8-positive T cell quantity (VT:0008077)	blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990)	9	1024537	67509080	Rat
1298088	Edpm11	Estrogen-dependent pituitary mass QTL 11	2.5		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	9	1	43718459	Rat
9589133	Insul26	Insulin level QTL 26	17.96	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	9	8952560	53952560	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
1	1	86	8	8	3	5	3	1	13	6	85	3	16	5


RefSeq Transcripts	NM_001106895	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001401661	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039083189	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473987	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000065053 ⟹ ENSRNOP00000063362

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	21,680,577 - 21,740,728 (+)	Ensembl
Rnor_6.0 Ensembl	9	25,304,876 - 25,365,151 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000101279 ⟹ ENSRNOP00000078078

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	21,680,809 - 21,740,728 (+)	Ensembl

RefSeq Acc Id:

NM_001106895 ⟹ NP_001100365

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	29,177,096 - 29,237,247 (+)	NCBI
mRatBN7.2	9	21,680,577 - 21,740,728 (+)	NCBI
Rnor_6.0	9	25,304,876 - 25,365,151 (+)	NCBI
Rnor_5.0	9	24,167,386 - 24,227,643 (+)	NCBI
RGSC_v3.4	9	17,936,724 - 18,006,941 (+)	RGD
Celera	9	19,269,921 - 19,328,727 (+)	RGD

Sequence:

show sequence

CCAGGGAGCTGCTTTTGTGCAGAGGGAAAATTTTGTTCCTACAGGTTTTTAAGTGGGTACGAGGCAAGGAGCTATCTGATCCGGGCAAAACCATTACAGTTTAGATCTCTATCTACGGAACATTTTTT
TCTTCCTTTAAAAAAATTGGAAAATACAAGAAGTTTTGGATTTTTTTTCCTGATTCTTTTTTTGGAGGGGGAAATTGCATCGTAAGCTTTTGGAGAAACCCAACATGTCAACTACCTTTCCCGGACTA
GTCCACGATGCCGAGGGTTCTGTGGAAGCCCAGTGTGGGATTGTCCTCAACGGCCAAGGGGGTGTGATAAGAAGAGGTGGCACCTGTGTGGTCAACCCCACAGACTTGTTTTGCTCAGTTCCTGGTCG
TTTGTCCCTTCTCAGTTCTACTTCCAAATACAAGGTGACCATTGCTGAGGTAAAGAGGCGTCTCTCACCACCCGAGTGCCTCAATGCTTCACTTCTGGGAGGCATTCTGAGGAGAGCAAAATCCAAGA
ATGGTGGTCGCTGCTTGAGAGAGAAACTAGACAGGCTTGGCTTAAACTTGCCAGCCGGAAGACGGAAAGCAGCCAACGTTACCTTGCTCACTTCCTTAGTCGAAGGAGAGGCTTTGCACTTGGCTAGG
GATTTTGGCTACACATGCGAAACAGAGTTTCCAGCCAAGGCAGTAGGAGAACATCTCGCCAGACAACATATGGAACAGAAAGAACAGACAGCACGGAAAAAGATGATCCTAGCGACCAAGCAAATTTG
TAAAGAATTCCAAGACCTCCTGAGTCAAGATAGATCACCACTGGGATCCTCCCGACCGACTCCCATTCTAGACCTTGACATCCAGAGGCACTTAACACATTTCAGTTTGATCACTCATGGTTTTGGGA
CACCAGCAATATGTGCAGCCCTAAGCACTTTCCAAACAGTCCTCAGTGAGATGCTTAACTACTTGGAAAAACACACGACTCACAAAAACGGTGGTGCTGCAGACTCTGGCCAAGGACATGCCAACTCG
GAGAAAGCCCCGCTGCGGAAAGCTTCAGAGGCTGCTGTGAAAGAGGGCAAAACAGAAAAGACAGACTAGCTACATCAAACAGAATCTATTTCTAGAGAGTCTTGCTGCTCATATTTTTTTTCTAATAT
ATATATCATTGGGGGTGACTAATCTTCAGTGGACCAAATCTTTACCCTTCCCGAGCCCTCCATAAAATAAAGTCAAAAGTGGAAATGAAAA

hide sequence

RefSeq Acc Id:

NM_001401661 ⟹ NP_001388590

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	29,177,098 - 29,237,247 (+)	NCBI
mRatBN7.2	9	21,680,579 - 21,740,728 (+)	NCBI

RefSeq Acc Id:

XM_039083189 ⟹ XP_038939117

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	29,178,197 - 29,241,412 (+)	NCBI
mRatBN7.2	9	21,681,276 - 21,744,840 (+)	NCBI


Protein RefSeqs	NP_001100365	(Get FASTA)	NCBI Sequence Viewer
	NP_001388590	(Get FASTA)	NCBI Sequence Viewer
	XP_038939117	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM18663	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000063362
	ENSRNOP00000063362.1
	ENSRNOP00000078078
	ENSRNOP00000078078.1

RefSeq Acc Id:	NP_001100365 ⟸ NM_001106895
- Peptide Label:	isoform 2
- UniProtKB:	D3ZYF2 (UniProtKB/TrEMBL), A6JJ69 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSTTFPGLVHDAEGSVEAQCGIVLNGQGGVIRRGGTCVVNPTDLFCSVPGRLSLLSSTSKYKVTIAEVKRRLSPPECLNASLLGGILRRAKSKNGGRCLREKLDRLGLNLPAGRRKAANVTLLTSLVE GEALHLARDFGYTCETEFPAKAVGEHLARQHMEQKEQTARKKMILATKQICKEFQDLLSQDRSPLGSSRPTPILDLDIQRHLTHFSLITHGFGTPAICAALSTFQTVLSEMLNYLEKHTTHKNGGAAD SGQGHANSEKAPLRKASEAAVKEGKTEKTD hide sequence

Ensembl Acc Id:

ENSRNOP00000063362 ⟸ ENSRNOT00000065053

RefSeq Acc Id:	XP_038939117 ⟸ XM_039083189
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000078078 ⟸ ENSRNOT00000101279

RefSeq Acc Id:	NP_001388590 ⟸ NM_001401661
- Peptide Label:	isoform 1
- UniProtKB:	A0A8I5ZJN7 (UniProtKB/TrEMBL)

Protein Domains

Transcription factor AP-2 C-terminal

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZYF2-F1-model_v2	AlphaFold	D3ZYF2	1-286	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-28046	BioCyc
Ensembl Genes	ENSRNOG00000011642	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000065053	ENTREZGENE
	ENSRNOT00000065053.2	UniProtKB/TrEMBL
	ENSRNOT00000101279	ENTREZGENE
	ENSRNOT00000101279.1	UniProtKB/TrEMBL
InterPro	TF_AP2	UniProtKB/TrEMBL
	TF_AP2_C	UniProtKB/TrEMBL
NCBI Gene	301284	ENTREZGENE
PANTHER	TF_AP2	UniProtKB/TrEMBL
	TRANSCRIPTION FACTOR AP-2-DELTA	UniProtKB/TrEMBL
Pfam	TF_AP-2	UniProtKB/TrEMBL
PhenoGen	Tfap2d	PhenoGen
PRINTS	AP2TNSCPFCT	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000011642	RatGTEx
UniProt	A0A8I5ZJN7	ENTREZGENE, UniProtKB/TrEMBL
	A6JJ69	ENTREZGENE, UniProtKB/TrEMBL
	D3ZYF2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-06-09	Tfap2d	transcription factor AP-2 delta	Tcfap2d	transcription factor AP-2, delta	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Tcfap2d	transcription factor AP-2, delta	Tcfap2d_predicted	transcription factor AP-2, delta (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Tcfap2d_predicted	transcription factor AP-2, delta (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message