Advanced Search (OLGA)

Gene: Tfap2d (transcription factor AP-2 delta) Rattus norvegicus

Analyze

Symbol:

Tfap2d

Name:

transcription factor AP-2 delta

RGD ID:

1304864

Description:

Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II transcription regulatory region sequence-specific DNA binding activity. Predicted to be involved in regulation of DNA-templated transcription. Predicted to act upstream of or within inferior colliculus development; negative regulation of neuron apoptotic process; and positive regulation of transcription by RNA polymerase II. Predicted to be located in nucleus. Predicted to be part of transcription regulator complex. Orthologous to human TFAP2D (transcription factor AP-2 delta); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC301284; Tcfap2d; transcription factor AP-2, delta; transcription factor AP-2-delta

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TFAP2D (transcription factor AP-2 delta)	HGNC	Ensembl, Inparanoid, NCBI, OrthoDB, Panther
Mus musculus (house mouse):	Tfap2d (transcription factor AP-2, delta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tfap2d (transcription factor AP-2 delta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TFAP2D (transcription factor AP-2 delta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TFAP2D (transcription factor AP-2 delta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tfap2d (transcription factor AP-2 delta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TFAP2D (transcription factor AP-2 delta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TFAP2D (transcription factor AP-2 delta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tfap2d (transcription factor AP-2 delta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Tfap2d (transcription factor AP-2 delta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SPATA6L (spermatogenesis associated 6 like)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Tfap2d (transcription factor AP-2, delta)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Tfap2d (transcription factor AP-2, delta)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	TFAP2D (transcription factor AP-2 delta)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	TFAP2D (transcription factor AP-2 delta)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tfap2d (transcription factor AP-2 delta (activating enhancer binding protein 2 delta))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tfap2d (transcription factor AP-2 delta (activating enhancer binding protein 2 delta))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	aptf-1	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	aptf-1	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	TfAP-2	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	TfAP-2	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector)
Xenopus tropicalis (tropical clawed frog):	tfap2d	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	tfap2d	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	29,177,096 - 29,241,412 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	9	29,177,096 - 29,237,247 (+)	Ensembl				GRCr8
mRatBN7.2	9	21,680,577 - 21,744,840 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	21,680,577 - 21,740,728 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	9	30,165,099 - 30,223,175 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	35,311,336 - 35,369,776 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	33,607,510 - 33,665,582 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	25,304,876 - 25,365,151 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	25,304,876 - 25,365,151 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	9	24,167,386 - 24,227,643 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	9	17,936,724 - 18,006,941 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	9	19,269,921 - 19,328,727 (+)	NCBI		Celera
RGSC_v3.1	9	17,933,765 - 18,004,235 (+)	NCBI
Cytogenetic Map	9	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

dibutyl phthalate (ISO)

fulvestrant (ISO)

ketamine (EXP)

lead diacetate (EXP)

N,N-diethyl-m-toluamide (EXP)

permethrin (EXP)

silicon dioxide (ISO)

sodium arsenite (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

inferior colliculus development (ISO)

negative regulation of neuron apoptotic process (ISO)

positive regulation of DNA-templated transcription (ISO)

positive regulation of transcription by RNA polymerase II (IEA,ISO)

regulation of DNA-templated transcription (IEA)

Cellular Component

nucleus (IEA)

transcription regulator complex (IEA,ISO)

Molecular Function

DNA binding (IEA)

DNA-binding transcription factor activity (IEA)

DNA-binding transcription factor activity, RNA polymerase II-specific (IEA,ISO)

protein binding (ISO)

RNA polymerase II transcription regulatory region sequence-specific DNA binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:11522791	PMID:21858141

Genomics

Comparative Map Data

Tfap2d
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	29,177,096 - 29,241,412 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	9	29,177,096 - 29,237,247 (+)	Ensembl				GRCr8
mRatBN7.2	9	21,680,577 - 21,744,840 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	21,680,577 - 21,740,728 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	9	30,165,099 - 30,223,175 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	35,311,336 - 35,369,776 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	33,607,510 - 33,665,582 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	25,304,876 - 25,365,151 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	25,304,876 - 25,365,151 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	9	24,167,386 - 24,227,643 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	9	17,936,724 - 18,006,941 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	9	19,269,921 - 19,328,727 (+)	NCBI		Celera
RGSC_v3.1	9	17,933,765 - 18,004,235 (+)	NCBI
Cytogenetic Map	9	q13	NCBI

TFAP2D
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	50,713,526 - 50,773,033 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	50,713,526 - 50,773,033 (+)	Ensembl			hg38	GRCh38
GRCh37	6	50,681,239 - 50,740,746 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	50,789,216 - 50,848,705 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	6	50,789,215 - 50,848,705	NCBI
Celera	6	52,237,300 - 52,296,828 (+)	NCBI		Celera
Cytogenetic Map	6	p12.3	NCBI
HuRef	6	50,413,057 - 50,472,532 (+)	NCBI		HuRef
CHM1_1	6	50,684,197 - 50,743,722 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	50,556,563 - 50,616,124 (+)	NCBI		T2T-CHM13v2.0

Tfap2d
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	19,173,246 - 19,244,172 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	19,173,246 - 19,236,570 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	1	19,103,022 - 19,173,948 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	19,103,022 - 19,166,346 (+)	Ensembl			mm10	GRCm38
MGSCv37	1	19,093,103 - 19,156,419 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	1	19,088,238 - 19,151,552 (+)	NCBI		MGSCv36	mm8
Celera	1	18,998,088 - 19,060,944 (+)	NCBI		Celera
Cytogenetic Map	1	A3	NCBI
cM Map	1	6.08	NCBI

Tfap2d
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955411	7,216,832 - 7,276,356 (-)	Ensembl
ChiLan1.0	NW_004955411	7,219,474 - 7,276,350 (-)	NCBI	ChiLan1.0	ChiLan1.0

TFAP2D
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	65,188,390 - 65,248,031 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	61,053,645 - 61,113,268 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	50,274,808 - 50,332,788 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	51,531,757 - 51,590,888 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	51,531,757 - 51,590,888 (+)	Ensembl			panPan2	panpan1.1

TFAP2D
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	18,447,086 - 18,504,137 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	18,447,105 - 18,504,142 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	18,339,916 - 18,396,664 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	18,944,513 - 19,001,109 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	18,944,275 - 19,001,114 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	18,453,196 - 18,509,808 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	18,557,245 - 18,613,864 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	18,694,770 - 18,751,403 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Tfap2d
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	53,970,148 - 54,027,942 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936476	9,932,156 - 9,990,037 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936476	9,933,247 - 9,996,375 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TFAP2D
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	44,640,281 - 44,703,562 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	7	44,640,281 - 44,702,561 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	50,994,878 - 51,057,262 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TFAP2D
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	21,671,570 - 21,733,003 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	21,671,752 - 21,727,772 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666044	50,660,481 - 50,717,179 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tfap2d
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624855	5,431,715 - 5,491,952 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624855	5,430,283 - 5,491,961 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Tfap2d
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	4	96,681,357 - 96,740,197 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Tfap2d
665 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	32
Count of miRNA genes:	25
Interacting mature miRNAs:	32
Transcripts:	ENSRNOT00000065053
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2303170	Bp332	Blood pressure QTL 332	3.73	0.027	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	6714888	84474983	Rat
631211	Bw4	Body weight QTL4	5.31		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	9	5346479	50346479	Rat
2303559	Gluco54	Glucose level QTL 54	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	9	8750492	53750492	Rat
7207814	Bmd91	Bone mineral density QTL 91	3.5		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	9	1	31250552	Rat
9589055	Scfw5	Subcutaneous fat weight QTL 5	5.55	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	9	496645	45496645	Rat
1641911	Alcrsp13	Alcohol response QTL 13			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	9	6214995	51214995	Rat
1354650	Despr5	Despair related QTL 5	4.01	0.0017	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	9	8750492	53750492	Rat
1300124	Cm4	Cardiac mass QTL 4	3.55		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	9	1	41763315	Rat
61425	Cia15	Collagen induced arthritis QTL 15	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	9	5346479	50416711	Rat
631643	Bp120	Blood pressure QTL 120	3	0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	6714888	29567695	Rat
9589158	Gluco65	Glucose level QTL 65	6.82	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	9	496645	45496645	Rat
1600365	Mcs20	Mammary carcinoma susceptibility QTL 20	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	9	21031430	49025574	Rat
7411592	Foco8	Food consumption QTL 8	7.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	496645	45496645	Rat
1298088	Edpm11	Estrogen-dependent pituitary mass QTL 11	2.5		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	9	6214995	51214995	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
1	1	102	8	8	3	5	3	1	17	7	1	100	6	17	5	13	13

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106895	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001401661	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039083189	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473987	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000065053 ⟹ ENSRNOP00000063362

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	9	29,177,096 - 29,237,247 (+)	Ensembl
mRatBN7.2 Ensembl	9	21,680,577 - 21,740,728 (+)	Ensembl
Rnor_6.0 Ensembl	9	25,304,876 - 25,365,151 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000101279 ⟹ ENSRNOP00000078078

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	9	29,177,098 - 29,237,247 (+)	Ensembl
mRatBN7.2 Ensembl	9	21,680,809 - 21,740,728 (+)	Ensembl

RefSeq Acc Id:

NM_001106895 ⟹ NP_001100365

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	29,177,096 - 29,237,247 (+)	NCBI
mRatBN7.2	9	21,680,577 - 21,740,728 (+)	NCBI
Rnor_6.0	9	25,304,876 - 25,365,151 (+)	NCBI
Rnor_5.0	9	24,167,386 - 24,227,643 (+)	NCBI
RGSC_v3.4	9	17,936,724 - 18,006,941 (+)	RGD
Celera	9	19,269,921 - 19,328,727 (+)	RGD

Sequence:

show sequence

CCAGGGAGCTGCTTTTGTGCAGAGGGAAAATTTTGTTCCTACAGGTTTTTAAGTGGGTACGAGG
CAAGGAGCTATCTGATCCGGGCAAAACCATTACAGTTTAGATCTCTATCTACGGAACATTTTTT
TCTTCCTTTAAAAAAATTGGAAAATACAAGAAGTTTTGGATTTTTTTTCCTGATTCTTTTTTTG
GAGGGGGAAATTGCATCGTAAGCTTTTGGAGAAACCCAACATGTCAACTACCTTTCCCGGACTA
GTCCACGATGCCGAGGGTTCTGTGGAAGCCCAGTGTGGGATTGTCCTCAACGGCCAAGGGGGTG
TGATAAGAAGAGGTGGCACCTGTGTGGTCAACCCCACAGACTTGTTTTGCTCAGTTCCTGGTCG
TTTGTCCCTTCTCAGTTCTACTTCCAAATACAAGGTGACCATTGCTGAGGTAAAGAGGCGTCTC
TCACCACCCGAGTGCCTCAATGCTTCACTTCTGGGAGGCATTCTGAGGAGAGCAAAATCCAAGA
ATGGTGGTCGCTGCTTGAGAGAGAAACTAGACAGGCTTGGCTTAAACTTGCCAGCCGGAAGACG
GAAAGCAGCCAACGTTACCTTGCTCACTTCCTTAGTCGAAGGAGAGGCTTTGCACTTGGCTAGG
GATTTTGGCTACACATGCGAAACAGAGTTTCCAGCCAAGGCAGTAGGAGAACATCTCGCCAGAC
AACATATGGAACAGAAAGAACAGACAGCACGGAAAAAGATGATCCTAGCGACCAAGCAAATTTG
TAAAGAATTCCAAGACCTCCTGAGTCAAGATAGATCACCACTGGGATCCTCCCGACCGACTCCC
ATTCTAGACCTTGACATCCAGAGGCACTTAACACATTTCAGTTTGATCACTCATGGTTTTGGGA
CACCAGCAATATGTGCAGCCCTAAGCACTTTCCAAACAGTCCTCAGTGAGATGCTTAACTACTT
GGAAAAACACACGACTCACAAAAACGGTGGTGCTGCAGACTCTGGCCAAGGACATGCCAACTCG
GAGAAAGCCCCGCTGCGGAAAGCTTCAGAGGCTGCTGTGAAAGAGGGCAAAACAGAAAAGACAG
ACTAGCTACATCAAACAGAATCTATTTCTAGAGAGTCTTGCTGCTCATATTTTTTTTCTAATAT
ATATATCATTGGGGGTGACTAATCTTCAGTGGACCAAATCTTTACCCTTCCCGAGCCCTCCATA
AAATAAAGTCAAAAGTGGAAATGAAAA

hide sequence

RefSeq Acc Id:

NM_001401661 ⟹ NP_001388590

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	29,177,098 - 29,237,247 (+)	NCBI
mRatBN7.2	9	21,680,579 - 21,740,728 (+)	NCBI

RefSeq Acc Id:

XM_039083189 ⟹ XP_038939117

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	29,178,197 - 29,241,412 (+)	NCBI
mRatBN7.2	9	21,681,276 - 21,744,840 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001100365	(Get FASTA)	NCBI Sequence Viewer
	NP_001388590	(Get FASTA)	NCBI Sequence Viewer
	XP_038939117	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM18663	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000063362
	ENSRNOP00000063362.1
	ENSRNOP00000078078
	ENSRNOP00000078078.1

RefSeq Acc Id:	NP_001100365 ⟸ NM_001106895
- Peptide Label:	isoform 2
- UniProtKB:	D3ZYF2 (UniProtKB/TrEMBL), A6JJ69 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSTTFPGLVHDAEGSVEAQCGIVLNGQGGVIRRGGTCVVNPTDLFCSVPGRLSLLSSTSKYKVT IAEVKRRLSPPECLNASLLGGILRRAKSKNGGRCLREKLDRLGLNLPAGRRKAANVTLLTSLVE GEALHLARDFGYTCETEFPAKAVGEHLARQHMEQKEQTARKKMILATKQICKEFQDLLSQDRSP LGSSRPTPILDLDIQRHLTHFSLITHGFGTPAICAALSTFQTVLSEMLNYLEKHTTHKNGGAAD SGQGHANSEKAPLRKASEAAVKEGKTEKTD hide sequence

Ensembl Acc Id:

ENSRNOP00000063362 ⟸ ENSRNOT00000065053

RefSeq Acc Id:	XP_038939117 ⟸ XM_039083189
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000078078 ⟸ ENSRNOT00000101279

RefSeq Acc Id:	NP_001388590 ⟸ NM_001401661
- Peptide Label:	isoform 1
- UniProtKB:	A0A8I5ZJN7 (UniProtKB/TrEMBL)

Protein Domains

Transcription factor AP-2 C-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZYF2-F1-model_v2	AlphaFold	D3ZYF2	1-286	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1304864	AgrOrtholog
BioCyc Gene	G2FUF-28046	BioCyc
Ensembl Genes	ENSRNOG00000011642	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000065053	ENTREZGENE
	ENSRNOT00000065053.3	UniProtKB/TrEMBL
	ENSRNOT00000101279	ENTREZGENE
	ENSRNOT00000101279.2	UniProtKB/TrEMBL
InterPro	TF_AP2	UniProtKB/TrEMBL
	TF_AP2_C	UniProtKB/TrEMBL
NCBI Gene	301284	ENTREZGENE
PANTHER	TF_AP2	UniProtKB/TrEMBL
	TRANSCRIPTION FACTOR AP-2-DELTA	UniProtKB/TrEMBL
Pfam	TF_AP-2	UniProtKB/TrEMBL
PhenoGen	Tfap2d	PhenoGen
PRINTS	AP2TNSCPFCT	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000011642	RatGTEx
UniProt	A0A8I5ZJN7	ENTREZGENE, UniProtKB/TrEMBL
	A6JJ69	ENTREZGENE, UniProtKB/TrEMBL
	D3ZYF2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-06-09	Tfap2d	transcription factor AP-2 delta	Tcfap2d	transcription factor AP-2, delta	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Tcfap2d	transcription factor AP-2, delta	Tcfap2d_predicted	transcription factor AP-2, delta (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Tcfap2d_predicted	transcription factor AP-2, delta (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message