Dlx2 (distal-less homeobox 2) - Rat Genome Database

Name: Dlx2
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Dlx2 (distal-less homeobox 2) Rattus norvegicus

Analyze

Symbol:

Dlx2

Name:

distal-less homeobox 2

RGD ID:

1304853

Description:

Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific; chromatin binding activity; and nucleic acid binding activity. Involved in response to insulin and response to organic cyclic compound. Predicted to be located in nucleus. Orthologous to human DLX2 (distal-less homeobox 2); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

DLX-5; Dlx5; homeobox Dlx5; homeobox protein DLX-2; LOC296499

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DLX2 (distal-less homeobox 2)	HGNC	EggNOG, Ensembl, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, Treefam
Mus musculus (house mouse):	Dlx2 (distal-less homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Dlx2 (distal-less homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DLX2 (distal-less homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DLX2 (distal-less homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Dlx2 (distal-less homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DLX2 (distal-less homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DLX2 (distal-less homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Dlx2 (distal-less homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	DLX2 (distal-less homeobox 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|OrthoFinder\|PhylomeDB)
Mus musculus (house mouse):	Dlx2 (distal-less homeobox 2)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)
Danio rerio (zebrafish):	dlx2a (distal-less homeobox 2a)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	dlx2	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	76,777,912 - 76,781,255 (-)	NCBI		GRCr8
mRatBN7.2	3	56,370,238 - 56,373,581 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	56,370,483 - 56,373,597 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	59,769,269 - 59,771,154 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	68,352,878 - 68,354,763 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	66,114,992 - 66,116,877 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	58,180,088 - 58,181,971 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	58,180,088 - 58,181,971 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	64,665,449 - 64,667,332 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	53,852,209 - 53,854,092 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	53,747,472 - 53,750,805 (-)	NCBI
Celera	3	55,918,985 - 55,920,868 (-)	NCBI		Celera
Cytogenetic Map	3	q23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autistic disorder (ISO)

Craniofacial Abnormalities (ISO)

genetic disease (ISO)

split hand-foot malformation 5 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

15-acetyldeoxynivalenol (ISO)

17beta-estradiol (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3,3',5-triiodo-L-thyronine (ISO)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

8'-apo-beta,psi-caroten-8'-al (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-carotene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (ISO)

bisphenol F (ISO)

butanal (ISO)

C60 fullerene (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

cisplatin (ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

crocidolite asbestos (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

cylindrospermopsin (ISO)

dorsomorphin (ISO)

Enterolactone (ISO)

fluoranthene (ISO)

folic acid (ISO)

formaldehyde (ISO)

gentamycin (EXP)

glycidol (EXP)

glycine betaine (EXP)

graphite (EXP)

lead diacetate (ISO)

Licochalcone B (ISO)

methylisothiazolinone (ISO)

methylmercury chloride (ISO)

nickel atom (ISO)

nickel sulfate (ISO)

paracetamol (EXP,ISO)

phenylmercury acetate (ISO)

progesterone (ISO)

propanal (ISO)

pyriproxyfen (ISO)

quercetin (ISO)

resveratrol (ISO)

rotenone (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

tert-butyl hydroperoxide (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

triptonide (ISO)

urethane (ISO)

valproic acid (ISO)

vorinostat (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

branching morphogenesis of a nerve (IEA,ISO)

cartilage development (IEA,ISO)

cerebral cortex GABAergic interneuron differentiation (ISO)

cerebral cortex GABAergic interneuron fate commitment (IEA,ISO)

embryonic cranial skeleton morphogenesis (IEA,ISO)

embryonic skeletal system development (ISO)

forebrain neuron differentiation (IEA,ISO)

GABAergic neuron differentiation (ISO)

hippocampus development (IEA,ISO)

negative regulation of Notch signaling pathway (IEA,ISO)

negative regulation of oligodendrocyte differentiation (IEA,ISO)

negative regulation of photoreceptor cell differentiation (IEA,ISO,ISS)

negative regulation of transcription by RNA polymerase II (IEA,ISO)

neuroblast differentiation (IEA,ISO)

Notch signaling pathway (IEA,ISO)

odontogenesis of dentin-containing tooth (IEA,ISO)

olfactory bulb development (IEA,ISO)

oligodendrocyte differentiation (IEA,ISO)

positive regulation of amacrine cell differentiation (IEA,ISO,ISS)

positive regulation of cell differentiation (ISO,ISS)

positive regulation of transcription by RNA polymerase II (IEA,ISO,ISS)

proximal/distal pattern formation (IEA,ISO)

regulation of transcription by RNA polymerase II (ISO)

response to insulin (IEP)

response to organic cyclic compound (IEP)

subpallium development (IEA,ISO)

Cellular Component

nucleus (IEA,ISO)

Molecular Function

chromatin binding (IEA,ISO)

DNA binding (ISO)

DNA-binding transcription activator activity, RNA polymerase II-specific (IEA,ISO)

protein binding (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IEA)

RNA polymerase II transcription regulatory region sequence-specific DNA binding (IEA,ISO)

sequence-specific double-stranded DNA binding (ISO)

single-stranded RNA binding (IEA,ISO)

transcription cis-regulatory region binding (ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Increased expression of the receptor for activation of NF-kappaB and decreased runt-related transcription factor 2 expression in bone of rats with streptozotocin-induced diabetes.	Hie M and Tsukamoto I, Int J Mol Med. 2010 Oct;26(4):611-8. doi: 10.3892/ijmm_00000506.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:7590232	PMID:8613727	PMID:9187081	PMID:9415433	PMID:10516593	PMID:11163262	PMID:12397111	PMID:12724837	PMID:14769946	PMID:15028753	PMID:16705037	PMID:17678855
PMID:21397028	PMID:21875655	PMID:22920256	PMID:23042297	PMID:28276447

Genomics

Comparative Map Data

Dlx2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	76,777,912 - 76,781,255 (-)	NCBI		GRCr8
mRatBN7.2	3	56,370,238 - 56,373,581 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	56,370,483 - 56,373,597 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	59,769,269 - 59,771,154 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	68,352,878 - 68,354,763 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	66,114,992 - 66,116,877 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	58,180,088 - 58,181,971 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	58,180,088 - 58,181,971 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	64,665,449 - 64,667,332 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	53,852,209 - 53,854,092 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	53,747,472 - 53,750,805 (-)	NCBI
Celera	3	55,918,985 - 55,920,868 (-)	NCBI		Celera
Cytogenetic Map	3	q23	NCBI

DLX2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	172,099,438 - 172,102,900 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	172,099,438 - 172,102,900 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	172,964,166 - 172,967,628 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	172,672,412 - 172,675,724 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	172,789,673 - 172,792,773	NCBI
Celera	2	166,580,267 - 166,583,579 (-)	NCBI		Celera
Cytogenetic Map	2	q31.1	NCBI
HuRef	2	164,844,417 - 164,847,729 (-)	NCBI		HuRef
CHM1_1	2	172,971,642 - 172,974,954 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	172,585,681 - 172,589,143 (-)	NCBI		T2T-CHM13v2.0

Dlx2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	71,373,752 - 71,377,095 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	71,373,752 - 71,377,098 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	71,543,408 - 71,546,754 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	71,543,408 - 71,546,754 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	71,381,465 - 71,384,811 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	71,344,248 - 71,347,580 (-)	NCBI		MGSCv36	mm8
Celera	2	73,207,643 - 73,210,989 (-)	NCBI		Celera
Cytogenetic Map	2	C2	NCBI
cM Map	2	42.65	NCBI

Dlx2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955449	2,907,436 - 2,910,816 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955449	2,907,502 - 2,909,893 (+)	NCBI	ChiLan1.0	ChiLan1.0

DLX2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	74,783,594 - 74,787,065 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	74,798,567 - 74,802,038 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	59,396,841 - 59,400,297 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	176,853,913 - 176,857,079 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	176,853,913 - 176,857,079 (-)	Ensembl	panpan1.1		panPan2

DLX2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	36	16,499,009 - 16,502,365 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	36	16,484,302 - 16,502,510 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	36	16,508,796 - 16,511,076 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	36	16,620,999 - 16,623,300 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	36	16,708,478 - 16,710,771 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	36	16,708,852 - 16,711,145 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	36	16,812,771 - 16,815,070 (-)	NCBI		UU_Cfam_GSD_1.0

Dlx2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	133,708,086 - 133,711,491 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936509	2,262,873 - 2,265,391 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936509	2,262,873 - 2,265,391 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DLX2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	78,200,916 - 78,204,112 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	15	78,200,696 - 78,204,264 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	87,651,312 - 87,654,827 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DLX2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	57,604,989 - 57,609,487 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	57,606,084 - 57,608,079 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	141,939,956 - 141,943,396 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dlx2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624787	9,530,034 - 9,533,109 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624787	9,528,942 - 9,532,252 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Dlx2
8 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	33
Count of miRNA genes:	32
Interacting mature miRNAs:	33
Transcripts:	ENSRNOT00000002076
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	10861912	89878372	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	15005422	76927699	Rat
631676	Cm8	Cardiac mass QTL 8	7.03	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	3	16954708	61954708	Rat
10450804	Scl70	Serum cholesterol level QTL 70	4.7	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	20714090	65714090	Rat
10450794	Scl69	Serum cholesterol level QTL 69	6.3	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	20714090	65714090	Rat
2302055	Pia30	Pristane induced arthritis QTL 30	3.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	3	27936919	72936919	Rat
9590286	Uminl1	Urine mineral level QTL 1	3.5	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	3	28249687	73249687	Rat
8694196	Abfw2	Abdominal fat weight QTL 2	16.58	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	3	28249687	73249687	Rat
8694386	Bw159	Body weight QTL 159	4.52	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	3	28249687	73249687	Rat
8552950	Pigfal12	Plasma insulin-like growth factor 1 level QTL 12	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	28249687	73249687	Rat
9590136	Scort3	Serum corticosterone level QTL 3	23.37	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	28249687	73249687	Rat
2303593	Gluco46	Glucose level QTL 46	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	28468571	73468571	Rat
1354590	Despr11	Despair related QTL 11		0.000031	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	3	28468571	73468571	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	30356773	98535386	Rat
61356	Bp37	Blood pressure QTL 37	3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	3	30684642	75684642	Rat
631647	Bp122	Blood pressure QTL 122	6.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	30684642	75684642	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
11565451	Bw177	Body weight QTL 177		0.002	body mass (VT:0001259)	body weight (CMO:0000012)	3	31426403	70668733	Rat
11565452	Kidm57	Kidney mass QTL 57		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	31426403	70668733	Rat
12879866	Cm94	Cardiac mass QTL 94		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	31426403	70668733	Rat
12879867	Cm95	Cardiac mass QTL 95		0.047	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	31426403	70668733	Rat
12879868	Am6	Aortic mass QTL 6		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	31426403	70668733	Rat
2301400	Cm68	Cardiac mass QTL 68		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	31426403	70668733	Rat
1300169	Bp177	Blood pressure QTL 177	2.96		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	3	33703347	61017857	Rat
1354589	Bw31	Body weight QTL 31	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	78196190	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	104104347	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
738019	Anxrr10	Anxiety related response QTL 10	3.9		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	3	38517803	83517803	Rat
2302276	Bw82	Body weight QTL 82	4.32		body mass (VT:0001259)	body weight (CMO:0000012)	3	39454637	62951183	Rat
1331777	Bw24	Body weight QTL 24	3.503		body mass (VT:0001259)	body weight (CMO:0000012)	3	39454637	89115240	Rat
1331795	Rf30	Renal function QTL 30	3.708		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	3	39454637	89115240	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	41874578	104104347	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1300178	Hrtrt4	Heart rate QTL 4	3.74		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	43827364	90905114	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	50437504	115638231	Rat
1582249	Bw77	Body weight QTL 77	3.2	0.0025	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	64655484	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	115665732	Rat
61377	Edpm3	Estrogen-dependent pituitary mass QTL 3	7.05	0.038	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	53184692	89878207	Rat
731180	Bp152	Blood pressure QTL 152		0.03	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	53781112	91609953	Rat
731180	Bp152	Blood pressure QTL 152		0.03	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	3	53781112	91609953	Rat
731180	Bp152	Blood pressure QTL 152		0.03	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	53781112	91609953	Rat

Markers in Region

U51002

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	56,370,667 - 56,370,805 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	58,179,409 - 58,179,546	NCBI	Rnor6.0
Rnor_5.0	3	64,664,770 - 64,664,907	UniSTS	Rnor5.0
RGSC_v3.4	3	53,851,530 - 53,851,667	UniSTS	RGSC3.4
Celera	3	55,918,306 - 55,918,443	UniSTS
Cytogenetic Map	3	q21	UniSTS

AW121999

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	56,370,419 - 56,370,544 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	58,179,161 - 58,179,285	NCBI	Rnor6.0
Rnor_5.0	3	64,664,522 - 64,664,646	UniSTS	Rnor5.0
RGSC_v3.4	3	53,851,282 - 53,851,406	UniSTS	RGSC3.4
Celera	3	55,918,058 - 55,918,182	UniSTS
Cytogenetic Map	3	q21	UniSTS

Dlx2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	56,372,338 - 56,373,093 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	58,181,080 - 58,181,834	NCBI	Rnor6.0
Rnor_5.0	3	64,666,441 - 64,667,195	UniSTS	Rnor5.0
RGSC_v3.4	3	53,853,201 - 53,853,955	UniSTS	RGSC3.4
Celera	3	55,919,977 - 55,920,731	UniSTS
Cytogenetic Map	3	q21	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	appendage
High
Medium								34
Low		8	2	2	2			22	4	12
Below cutoff	3	8	6	6	6	2	2	14	12	7	2

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001191746	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	S81930	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000002076 ⟹ ENSRNOP00000002076

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	56,370,483 - 56,373,597 (-)	Ensembl
Rnor_6.0 Ensembl	3	58,180,088 - 58,181,971 (-)	Ensembl

RefSeq Acc Id:

NM_001191746 ⟹ NP_001178675

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	76,777,912 - 76,781,255 (-)	NCBI
mRatBN7.2	3	56,370,238 - 56,373,581 (-)	NCBI
Rnor_6.0	3	58,180,088 - 58,181,971 (-)	NCBI
Rnor_5.0	3	64,665,449 - 64,667,332 (-)	NCBI
Celera	3	55,918,985 - 55,920,868 (-)	NCBI

Sequence:

show sequence

ATGACTGGAGTCTTTGACAGTCTGGTGGCTGATATGCACTCGACCCAGATCACAGCCTCCAGCA
CGTACCACCAGCACCAGCAGCCCCCGAGCGGTGCGGGCGCGGGCTCTGGCGGCAGCAGCAACAG
CAGCAGCAGCAACAGCAACCTGCACAAGCCCCAGGAGTCGCCAACCCTGCCGGTGTCCACGGCT
ACCGACAGCAGCTACTACACCAACCAGCAGCACCCGGCGGGTGGCGGCGGCGGGGGGGCCTCGC
CCTACGCGCACATGGGCTCCTACCAGTACCACGCCAGCGGCCTCAACAACGTCTCCTACTCCGC
CAAAAGCAGCTACGACCTGGGCTACACCGCCGCGTACACTTCCTACGCGCCCTACGGAACCAGT
TCGTCCCCAGTCAACAACGAGCCCGACAAGGAAGACCTTGAGCCTGAAATCCGAATTGTGAACG
GGAAGCCAAAGAAAGTCCGGAAACCACGCACCATCTACTCCAGTTTCCAGCTGGCCGCCCTTCA
GCGACGCTTCCAGAAGACCCAGTATCTGGCCCTGCCTGAGCGAGCCGAGCTGGCGGCCTCCCTG
GGCCTTACCCAAACTCAGGTCAAAATCTGGTTCCAGAACCGCCGATCCAAGTTCAAGAAGATGT
GGAAGAGTGGCGAGATCCCCACAGAGCAGCACCCTGGAGCCAGCGCTTCCCCACCATGTGCCTC
CCCGCCGGTTTCGGCGCCAGCATCCTGGGACTTCGGCGCGCAACAGCGGATGGCGGGCGGCGGC
CCAGGCAGCGGAGGCAGCGGCGCGGGCAGCTCCGGCTCCAGCCCGAGCAGCGCCGCCTCGGCTT
TTCTGGGAAACTACCCGTGGTACCACCAGGCTTCGGGCTCCGCTTCACACCTGCAGGCCACTGC
GCCACTTCTGCATCCCTCGCAGACTCCGCAGGCGCACCACCACCACCACCATCACCACCACGCA
GGCGGGGGCGCCCCGGTGAGCGCCGGGACGATTTTCTAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001178675	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAP32274	(Get FASTA)	NCBI Sequence Viewer
	EDL79105	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000002076
	ENSRNOP00000002076.3
GenBank Protein	Q64204	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001178675 ⟸ NM_001191746

- UniProtKB:

G3V668 (UniProtKB/TrEMBL), A6HM54 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MTGVFDSLVADMHSTQITASSTYHQHQQPPSGAGAGSGGSSNSSSSNSNLHKPQESPTLPVSTA
TDSSYYTNQQHPAGGGGGGASPYAHMGSYQYHASGLNNVSYSAKSSYDLGYTAAYTSYAPYGTS
SSPVNNEPDKEDLEPEIRIVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASL
GLTQTQVKIWFQNRRSKFKKMWKSGEIPTEQHPGASASPPCASPPVSAPASWDFGAQQRMAGGG
PGSGGSGAGSSGSSPSSAASAFLGNYPWYHQASGSASHLQATAPLLHPSQTPQAHHHHHHHHHA
GGGAPVSAGTIF

hide sequence

RefSeq Acc Id:

ENSRNOP00000002076 ⟸ ENSRNOT00000002076

Protein Domains

Homeobox

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q64204-F1-model_v2	AlphaFold	Q64204	1-83	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1304853	AgrOrtholog
BioCyc Gene	G2FUF-49460	BioCyc
Ensembl Genes	ENSRNOG00000001519	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000002076	ENTREZGENE
	ENSRNOT00000002076.6	UniProtKB/TrEMBL
Gene3D-CATH	Homeodomain-like	UniProtKB/TrEMBL
InterPro	Distal-less_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Homeobox	UniProtKB/TrEMBL
	Homeobox_CS	UniProtKB/TrEMBL
	Homeobox_eu	UniProtKB/TrEMBL
	Homeodomain-like	UniProtKB/TrEMBL
	HTH_motif	UniProtKB/TrEMBL
KEGG Report	rno:296499	UniProtKB/TrEMBL
NCBI Gene	296499	ENTREZGENE
PANTHER	HOMEOBOX PROTEIN	UniProtKB/TrEMBL
	HOMEOBOX PROTEIN DLX-2	UniProtKB/TrEMBL
Pfam	DLL_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Homeobox	UniProtKB/TrEMBL
PhenoGen	Dlx2	PhenoGen
PRINTS	HOMEOBOX	UniProtKB/TrEMBL
	HTHREPRESSR	UniProtKB/TrEMBL
PROSITE	HOMEOBOX_1	UniProtKB/TrEMBL
	HOMEOBOX_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000001519	RatGTEx
SMART	HOX	UniProtKB/TrEMBL
Superfamily-SCOP	Homeodomain_like	UniProtKB/TrEMBL
UniProt	A6HM54	ENTREZGENE, UniProtKB/TrEMBL
	DLX2_RAT	UniProtKB/Swiss-Prot
	G3V668	ENTREZGENE, UniProtKB/TrEMBL
	Q64204	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-12-06	Dlx2	distal-less homeobox 2	Dlx2_predicted	distal-less homeobox 2 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Dlx2_predicted	distal-less homeobox 2 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD