Serpina9 (serpin family A member 9)

Advanced Search (OLGA)

Gene: Serpina9 (serpin family A member 9) Rattus norvegicus

Analyze

Symbol:

Serpina9

Name:

serpin family A member 9

RGD ID:

1304789

Description:

Predicted to enable serine-type endopeptidase inhibitor activity. Predicted to be involved in negative regulation of endopeptidase activity. Predicted to be active in extracellular space. Orthologous to human SERPINA9 (serpin family A member 9); INTERACTS WITH ammonium chloride; bisphenol A; gentamycin.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC299274; serine (or cysteine) peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 9; serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 9; serpin A9; serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 9; serpin peptidase inhibitor, clade A, member 9

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	128,683,650 - 128,700,784 (-)	NCBI		GRCr8
mRatBN7.2	6	122,918,819 - 122,936,000 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	122,918,880 - 122,936,000 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	123,059,784 - 123,076,902 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	123,355,064 - 123,372,182 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	122,691,927 - 122,709,053 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	127,662,348 - 127,680,232 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	127,662,813 - 127,679,951 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	136,881,410 - 136,898,530 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	128,052,256 - 128,069,518 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	128,056,362 - 128,072,771 (-)	NCBI
Celera	6	120,398,966 - 120,416,084 (-)	NCBI		Celera
Cytogenetic Map	6	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

DICER1 syndrome (ISO)

pleuropulmonary blastoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-palmitoylglycerol (ISO)

aflatoxin B1 (ISO)

amiodarone (ISO)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium sulfate (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chloroprene (ISO)

cyproconazole (ISO)

dibutyl phthalate (ISO)

dichloroacetic acid (ISO)

doxorubicin (ISO)

epoxiconazole (ISO)

furan (ISO)

genistein (ISO)

gentamycin (EXP)

glyphosate (EXP)

lipopolysaccharide (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

propiconazole (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silicon dioxide (ISO)

tetrachloromethane (ISO)

titanium dioxide (ISO)

triadimefon (ISO)

trichloroethene (EXP,ISO)

troglitazone (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

extracellular space (IBA)

Molecular Function

serine-type endopeptidase inhibitor activity (IBA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:15489334

Genomics

Comparative Map Data

Serpina9
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	128,683,650 - 128,700,784 (-)	NCBI		GRCr8
mRatBN7.2	6	122,918,819 - 122,936,000 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	122,918,880 - 122,936,000 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	123,059,784 - 123,076,902 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	123,355,064 - 123,372,182 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	122,691,927 - 122,709,053 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	127,662,348 - 127,680,232 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	127,662,813 - 127,679,951 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	136,881,410 - 136,898,530 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	128,052,256 - 128,069,518 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	128,056,362 - 128,072,771 (-)	NCBI
Celera	6	120,398,966 - 120,416,084 (-)	NCBI		Celera
Cytogenetic Map	6	q32	NCBI

SERPINA9
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	94,462,721 - 94,476,197 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	94,462,717 - 94,479,689 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	94,929,058 - 94,942,534 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	93,998,811 - 94,012,423 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	14	94,000,715 - 94,012,423	NCBI
Celera	14	74,984,948 - 74,998,549 (-)	NCBI		Celera
Cytogenetic Map	14	q32.13	NCBI
HuRef	14	75,109,316 - 75,122,913 (-)	NCBI		HuRef
CHM1_1	14	94,866,855 - 94,880,458 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	14	88,692,234 - 88,705,726 (-)	NCBI		T2T-CHM13v2.0

Serpina9
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	103,962,877 - 103,979,911 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	103,961,002 - 103,980,014 (-)	Ensembl		GRCm39 Ensembl
GRCm38	12	103,996,615 - 104,013,652 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	103,994,743 - 104,013,755 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	12	105,234,830 - 105,251,862 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	12	104,397,670 - 104,414,702 (-)	NCBI		MGSCv36	mm8
Celera	12	105,214,012 - 105,231,660 (-)	NCBI		Celera
Cytogenetic Map	12	E	NCBI
cM Map	12	52.98	NCBI

Serpina9
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955438	17,866,796 - 17,875,104 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955438	17,862,064 - 17,875,490 (+)	NCBI	ChiLan1.0	ChiLan1.0

SERPINA9
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	95,610,914 - 95,624,365 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	94,827,419 - 94,840,870 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	75,085,874 - 75,099,381 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	94,418,728 - 94,431,999 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

SERPINA9
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	63,473,622 - 63,487,720 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	63,473,687 - 63,488,556 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	63,050,176 - 63,064,142 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	63,740,521 - 63,754,568 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	63,740,505 - 63,754,602 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	63,415,783 - 63,429,810 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	63,468,110 - 63,482,144 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	63,798,760 - 63,812,804 (-)	NCBI		UU_Cfam_GSD_1.0

SERPINA9
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	72,247,517 - 72,255,199 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	72,248,001 - 72,254,999 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666053	59,473,350 - 59,485,363 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Serpina9
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624734	7,162,235 - 7,173,654 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624734	7,165,467 - 7,181,908 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Serpina9
61 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	155
Count of miRNA genes:	123
Interacting mature miRNAs:	131
Transcripts:	ENSRNOT00000012861
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
12801411	Schws8	Schwannoma susceptibility QTL 8			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	94968928	139968928	Rat
1331797	Bp213	Blood pressure QTL 213	3.291		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	104085867	128713626	Rat
1331799	Bp211	Blood pressure QTL 211	3.66407		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	72202632	130919985	Rat
71111	Iddm8	Insulin dependent diabetes mellitus QTL 8	1.9	0.002	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	6	105156861	140994061	Rat
1358355	Srcrt4	Stress Responsive Cort QTL 4	6.39		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	100364669	140994061	Rat
61329	Eae9	Experimental allergic encephalomyelitis QTL 9	3.7		body mass (VT:0001259)	change in body weight (CMO:0002045)	6	122549046	140994061	Rat
2313399	Anxrr28	Anxiety related response QTL 28			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	6	100671796	132340886	Rat
1331725	Bp212	Blood pressure QTL 212	3.52475		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	93701310	128713626	Rat
8552796	Vie3	Viral induced encephalitis QTL 3	2.6		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	6	96833997	140994061	Rat
4145118	Mcs26	Mammary carcinoma susceptibility QTL 26		0.0001	mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	6	106752656	132339866	Rat
1581563	Uae33	Urinary albumin excretion QTL 33			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	72227641	130729205	Rat
10054138	Gmadr3	Adrenal mass QTL 3	3.68	0.00045	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	6	85140138	130140138	Rat
1641917	Colcr5	Colorectal carcinoma resistance QTL 5	3.18	0.0009	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	6	122549046	137801795	Rat
61414	Pia3	Pristane induced arthritis QTL 3	4.5		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	6	94968928	137848904	Rat
724513	Uae14	Urinary albumin excretion QTL 14	6.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	85311061	133478515	Rat
2303624	Vencon5	Ventilatory control QTL 5	4.45		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	6	88047916	133047916	Rat
731173	Uae22	Urinary albumin excretion QTL 22	10.1		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
10054123	Srcrt6	Stress Responsive Cort QTL 6	2.5	0.0043	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	85140138	130140138	Rat
724536	Uae7	Urinary albumin excretion QTL 7	3.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	72202632	130729475	Rat
737976	Pia24	Pristane induced arthritis QTL 24			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	6	112636280	140994061	Rat
1298087	Iddm18	Insulin dependent diabetes mellitus QTL 18		0.0001	urine glucose amount (VT:0001758)	percentage of study population developing diabetes mellitus during a period of time (CMO:0001114)	6	116506292	130245370	Rat
1581550	Pur8	Proteinuria QTL 8			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	72227641	130729205	Rat
738034	Anxrr5	Anxiety related response QTL 5	5.9		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	6	84130881	129130881	Rat
2290393	Uae37	Urinary albumin excretion QTL 37		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
1300076	Glom8	Glomerulus QTL 8	7	9e-09	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	6	86894788	131894788	Rat
2293085	Iddm29	Insulin dependent diabetes mellitus QTL 29	7.66		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	6	122549046	140286318	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	renal system	reproductive system	respiratory system
1	13	11	31	40	15	8	15	6	49	26	7	46	25

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106754	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008764765	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039112074	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063261768	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC094636	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473982	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000012861 ⟹ ENSRNOP00000012861

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	122,918,880 - 122,936,000 (-)	Ensembl
Rnor_6.0 Ensembl	6	127,662,813 - 127,679,951 (-)	Ensembl

RefSeq Acc Id:

NM_001106754 ⟹ NP_001100224

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	128,683,664 - 128,700,784 (-)	NCBI
mRatBN7.2	6	122,918,880 - 122,936,000 (-)	NCBI
Rnor_6.0	6	127,662,813 - 127,679,951 (-)	NCBI
Rnor_5.0	6	136,881,410 - 136,898,530 (-)	NCBI
RGSC_v3.4	6	128,052,256 - 128,069,518 (-)	RGD
Celera	6	120,398,966 - 120,416,084 (-)	RGD

Sequence:

show sequence

TGAGCAGGAGCTGTGGTCGCCTTTGTTGTCCTACAGGGAAGGCAGGTGAGACTCCCTTCCTTCC
AAATGGGCTCTTCCTTTTACCGAGTTCTCCTAGTGGTTGGCTTCTGTGCTCCAATGTCCTGCAT
GTTGTCATTCAATTCCAACCACCGAGAGTGCCCCCACCCTCTCTCTATGAAGAGAAACCCAGCC
TCCCAGGTGACTCCCAGCAACACCAAGTTCGCCTTCCTCCTATACCAGAGGCTGGCTCAGAAGA
GTCCAGGTCAGAATATCCTCTTTTCTCCTGTGAGTATCTCTACTTCCCTGGCCATGCTGTCCCT
GGGGGCCTGCTCAGCCACCAAGACGCAGATCCTCCGGAGCCTCGGTTTCAACATCACGCACATT
GCGGAGCACACCATCCACCTGGGCTTCGAGCAGCTGGTCCACTCGCTGAACGAGTGCCACAAAG
ACCTGGAGTTGCGGATGGGCAGTGTCCTCTTCATCAGGAAGGAGCTACAGCTGCAGGTCAAGTT
TCTGGACAGGGTTAAAAAGCTTTATGGGACCAAAGTCTTTTCTGAAGACTTCTCAAATGCTGTT
ACTGCCCAGGCCCAGATCAACAGTTACGTGGAGAGGGAGACCAAAGGGAAGGTGGTGGATGTAA
TCCAAGACCTTGACTCTCAGACAGCAATGGTCCTGGTGAACCACATCTTCTTTAAAGCCAACTG
GACCCAGCCCTTTAGTGCTGCAAACACAAACAAGAGCTTCCCATTCCTTCTGAGCAAGGGCACC
ACTGTGCATGTTCCCATGATGCACCAGACCGAGTCGTTTGCCTTTGGAGTGGACAGAGAGCTGG
GCTGCTCTATTCTGCAGATGGACTACAGGGGAGATGCCGTGGCCTTCTTTGTCCTCCCTGGTAA
GGGCAAGATGCGGCAGCTGGAGAGGAGTCTGTCACCCAGGAGGCTGAGAAGATGGAGCCGCTCA
CTCCAGAAAAGGTGGATCAAGGTGTTCATCCCCAAATTTTCCATTTCTGCTTCCTACAACCTGG
AAACCATCCTCCCTGAGATGGGAATCCGAGACGCCTTTAACTCAAACGCTGACTTCTCCGGAAT
TACAAAGACACACTTCCTGCAGGTTTCTAAGGCTGCTCACAAGGCTGTACTGGATGTCAGCGAG
GAGGGGACAGAAGCCGCAGCAGCCACCACCACCAAACTAATAGTCCGCTCAAGGGACACCCCAT
CTTCCACCATCGCCTTCAATGAGCCCTTCCTGATTCTACTTCTAGATAAAAACACAGAATCCAT
TCTCTTTCTAGGGAAAGTTGAAAACCCCAGGAAAATGTAGATTGGAAGAGAGCTGTTGGCTGGC
CACACACTAATAATTCACAAGAAATAGGTGTGTGTCGGAAGACGCTAGCAAGGTGATATCAAGA
CCCATTTCCTTGATTGAGGTCTACTTGACTCCAACAGGAGAGCATTGGCCTTTGGGGTTGCACG
CTGGGGCCCAACCATAGAAGAGACATCAGGGTCTGGTCACCCTTCCAGTAGCCCCTCCCACCTG
CTTTCCCATGTAGCCTTTTTCTGGAATGTGACAGGGCAGGCACAGCTCAATGCCTCAGATCTCT
TGGGAATGGCGGCGCACAGGACTCGGTACCCTTGCTTTTACGGCTGACTCCCAGCACTGCATTC
AATAAACCTGAAATGT

hide sequence

RefSeq Acc Id:

XM_039112074 ⟹ XP_038968002

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	128,683,650 - 128,695,888 (-)	NCBI
mRatBN7.2	6	122,918,819 - 122,931,104 (-)	NCBI

RefSeq Acc Id:

XM_063261768 ⟹ XP_063117838

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	128,683,650 - 128,698,798 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001100224	(Get FASTA)	NCBI Sequence Viewer
	XP_038968002	(Get FASTA)	NCBI Sequence Viewer
	XP_063117838	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL81793	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000012861.3

RefSeq Acc Id:	NP_001100224 ⟸ NM_001106754
- Peptide Label:	precursor
- UniProtKB:	D3ZAT4 (UniProtKB/TrEMBL), A6JEP9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGSSFYRVLLVVGFCAPMSCMLSFNSNHRECPHPLSMKRNPASQVTPSNTKFAFLLYQRLAQKS PGQNILFSPVSISTSLAMLSLGACSATKTQILRSLGFNITHIAEHTIHLGFEQLVHSLNECHKD LELRMGSVLFIRKELQLQVKFLDRVKKLYGTKVFSEDFSNAVTAQAQINSYVERETKGKVVDVI QDLDSQTAMVLVNHIFFKANWTQPFSAANTNKSFPFLLSKGTTVHVPMMHQTESFAFGVDRELG CSILQMDYRGDAVAFFVLPGKGKMRQLERSLSPRRLRRWSRSLQKRWIKVFIPKFSISASYNLE TILPEMGIRDAFNSNADFSGITKTHFLQVSKAAHKAVLDVSEEGTEAAAATTTKLIVRSRDTPS STIAFNEPFLILLLDKNTESILFLGKVENPRKM hide sequence

Ensembl Acc Id:

ENSRNOP00000012861 ⟸ ENSRNOT00000012861

RefSeq Acc Id:	XP_038968002 ⟸ XM_039112074
- Peptide Label:	isoform X1
- UniProtKB:	D3ZAT4 (UniProtKB/TrEMBL), A6JEP9 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063117838 ⟸ XM_063261768
- Peptide Label:	isoform X1
- UniProtKB:	A6JEP9 (UniProtKB/TrEMBL), D3ZAT4 (UniProtKB/TrEMBL)

Protein Domains

SERPIN

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZAT4-F1-model_v2	AlphaFold	D3ZAT4	1-417	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1304789	AgrOrtholog
BioCyc Gene	G2FUF-36399	BioCyc
Ensembl Genes	ENSRNOG00000042391	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000012861.5	UniProtKB/TrEMBL
Gene3D-CATH	2.30.39.10	UniProtKB/TrEMBL
	3.30.497.10	UniProtKB/TrEMBL
	Serpins superfamily	UniProtKB/TrEMBL
InterPro	Protease_inhib_I4_serpin	UniProtKB/TrEMBL
	Sepin_dom	UniProtKB/TrEMBL
	Serpin_sf	UniProtKB/TrEMBL
	Serpin_sf_1	UniProtKB/TrEMBL
	Serpin_sf_2	UniProtKB/TrEMBL
KEGG Report	rno:299274	UniProtKB/TrEMBL
NCBI Gene	299274	ENTREZGENE
PANTHER	Prot_inh_serpin	UniProtKB/TrEMBL
	SERPIN A9	UniProtKB/TrEMBL
Pfam	Serpin	UniProtKB/TrEMBL
PhenoGen	Serpina9	PhenoGen
RatGTEx	ENSRNOG00000042391	RatGTEx
SMART	SERPIN	UniProtKB/TrEMBL
Superfamily-SCOP	Prot_inh_serpin	UniProtKB/TrEMBL
UniProt	A6JEP9	ENTREZGENE, UniProtKB/TrEMBL
	D3ZAT4	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-04-13	Serpina9	serpin family A member 9	Serpina9	serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 9	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-10-16	Serpina9	serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 9	Serpina9	serpin peptidase inhibitor, clade A, member 9	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-03-05	Serpina9	serpin peptidase inhibitor, clade A, member 9	Serpina9	serine (or cysteine) peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 9	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Serpina9	serine (or cysteine) peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 9	Serpina9_predicted	serine (or cysteine) peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 9 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-30	Serpina9_predicted	serine (or cysteine) peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 9 (predicted)		serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 9 (predicted)	Name updated	1299863	APPROVED
2005-01-12	Serpina9_predicted	serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 9 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar