Advanced Search (OLGA)

Gene: Vps37b (VPS37B subunit of ESCRT-I) Rattus norvegicus

Analyze

Symbol:

Vps37b

Name:

VPS37B subunit of ESCRT-I

RGD ID:

1304576

Description:

Predicted to enable calcium-dependent protein binding activity. Predicted to be involved in protein targeting to membrane; protein targeting to vacuole; and ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway. Predicted to be located in endosome membrane; midbody; and plasma membrane. Predicted to be part of ESCRT I complex. Orthologous to human VPS37B (VPS37B subunit of ESCRT-I); PARTICIPATES IN endocytosis pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC288659; RGD1304576; similar to Hypothetical protein MGC25614; vacuolar protein sorting 37 homolog B; vacuolar protein sorting 37 homolog B (S. cerevisiae); vacuolar protein sorting 37B; vacuolar protein sorting 37B (yeast); vacuolar protein sorting-associated protein 37B; VPS37B, ESCRT-I subunit

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	VPS37B (VPS37B subunit of ESCRT-I)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Vps37b (vacuolar protein sorting 37B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Vps37b (VPS37B subunit of ESCRT-I)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	VPS37B (VPS37B subunit of ESCRT-I)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	VPS37B (VPS37B subunit of ESCRT-I)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Vps37b (VPS37B subunit of ESCRT-I)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	VPS37B (VPS37B subunit of ESCRT-I)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	VPS37B (VPS37B subunit of ESCRT-I)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Vps37b (VPS37B subunit of ESCRT-I)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	VPS37B (VPS37B subunit of ESCRT-I)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	VPS37B (VPS37B subunit of ESCRT-I)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Vps37b (vacuolar protein sorting 37B)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Vps37b (vacuolar protein sorting 37B)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	vps37b (VPS37B subunit of ESCRT-I)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	vps37b (VPS37B subunit of ESCRT-I)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	vps-37	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	vps-37	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Vps37B	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Vps37B	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PANTHER)
Saccharomyces cerevisiae (baker's yeast):	SRN2	Alliance	DIOPT (OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	vps37bb	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	vps37bb	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	vps37b	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	vps37b	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	38,220,973 - 38,249,935 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	38,220,959 - 38,249,935 (+)	Ensembl				GRCr8
mRatBN7.2	12	32,560,047 - 32,589,015 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	32,560,047 - 32,589,014 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	33,738,996 - 33,767,751 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	34,350,337 - 34,379,095 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	33,402,228 - 33,430,986 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	37,984,790 - 38,023,369 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	37,984,790 - 38,023,368 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	39,857,153 - 39,894,366 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	33,684,358 - 33,713,075 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	34,248,132 - 34,276,582 (+)	NCBI		Celera
RGSC_v3.1	12	33,547,761 - 33,576,464 (+)	NCBI
Cytogenetic Map	12	q15	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,4-dinitrotoluene (EXP)

2-methylcholine (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

amitrole (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

Butylbenzyl phthalate (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

clobetasol (ISO)

clofibrate (ISO)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) chloride (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

disulfiram (ISO)

diuron (EXP)

endosulfan (EXP)

fenthion (ISO)

fipronil (EXP)

fluoranthene (ISO)

folic acid (ISO)

furan (EXP)

gentamycin (EXP)

glyphosate (ISO)

inulin (ISO)

isobutanol (ISO)

ivermectin (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methamphetamine (EXP)

methimazole (EXP)

okadaic acid (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

perfluorohexanesulfonic acid (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

propiconazole (EXP)

silver atom (ISO)

silver(0) (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

Soman (EXP)

sulfadimethoxine (EXP)

sunitinib (ISO)

thimerosal (ISO)

thioacetamide (EXP)

thiram (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

Triptolide (ISO)

valproic acid (ISO)

vinclozolin (EXP)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

macroautophagy (IEA)

multivesicular body assembly (IEA)

positive regulation of viral budding via host ESCRT complex (IEA)

protein targeting to membrane (IBA)

protein targeting to vacuole (IBA)

protein transport (IEA)

ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway (IBA)

viral budding via host ESCRT complex (IEA)

viral release from host cell (IEA)

Cellular Component

cytoplasm (IEA,ISO)

endosome (IEA,ISO)

endosome membrane (IEA,ISO)

ESCRT I complex (IBA,IEA,ISO)

late endosome membrane (IEA)

midbody (IEA,ISO)

plasma membrane (IEA,ISO)

Molecular Function

calcium-dependent protein binding (IEA,ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

endocytosis pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:15218037	PMID:17940959	PMID:18005716	PMID:19056867	PMID:19129479	PMID:22232651	PMID:22405001	PMID:23376485	PMID:23533145	PMID:23924735

Genomics

Comparative Map Data

Vps37b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	38,220,973 - 38,249,935 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	38,220,959 - 38,249,935 (+)	Ensembl				GRCr8
mRatBN7.2	12	32,560,047 - 32,589,015 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	32,560,047 - 32,589,014 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	33,738,996 - 33,767,751 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	34,350,337 - 34,379,095 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	33,402,228 - 33,430,986 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	37,984,790 - 38,023,369 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	37,984,790 - 38,023,368 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	39,857,153 - 39,894,366 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	33,684,358 - 33,713,075 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	34,248,132 - 34,276,582 (+)	NCBI		Celera
RGSC_v3.1	12	33,547,761 - 33,576,464 (+)	NCBI
Cytogenetic Map	12	q15	NCBI

VPS37B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	122,865,330 - 122,896,124 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	122,865,330 - 122,896,127 (-)	Ensembl			hg38	GRCh38
GRCh37	12	123,349,877 - 123,380,671 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	121,915,835 - 121,946,665 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	12	122,941,170 - 122,971,994 (-)	NCBI		Celera
Cytogenetic Map	12	q24.31	NCBI
HuRef	12	120,309,887 - 120,340,737 (-)	NCBI		HuRef
CHM1_1	12	123,318,165 - 123,349,007 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	122,860,577 - 122,891,354 (-)	NCBI		T2T-CHM13v2.0

Vps37b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	124,142,704 - 124,170,323 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	124,142,704 - 124,170,333 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	124,004,641 - 124,032,260 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	124,004,641 - 124,032,270 (-)	Ensembl			mm10	GRCm38
MGSCv37	5	124,454,650 - 124,482,269 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	124,265,259 - 124,292,878 (-)	NCBI		MGSCv36	mm8
Celera	5	121,077,230 - 121,104,435 (-)	NCBI		Celera
Cytogenetic Map	5	F	NCBI
cM Map	5	63.32	NCBI

Vps37b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955482	5,859,234 - 5,884,665 (+)	Ensembl
ChiLan1.0	NW_004955482	5,879,273 - 5,884,217 (+)	NCBI	ChiLan1.0	ChiLan1.0

VPS37B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	130,959,240 - 130,989,853 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	130,955,617 - 130,986,230 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	120,469,840 - 120,500,394 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	124,703,077 - 124,733,889 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	124,703,077 - 124,733,889 (-)	Ensembl			panPan2	panpan1.1

VPS37B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	6,594,981 - 6,621,902 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	6,595,030 - 6,620,408 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	6,756,791 - 6,783,698 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	6,844,105 - 6,871,052 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	6,844,140 - 6,871,052 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	6,776,943 - 6,803,891 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	6,869,672 - 6,896,611 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	6,823,302 - 6,850,224 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Vps37b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	157,702,859 - 157,734,398 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936558	1,744,914 - 1,776,574 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936558	1,745,041 - 1,776,562 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

VPS37B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	29,962,042 - 29,994,646 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	14	29,963,087 - 29,994,650 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	31,651,931 - 31,683,495 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

VPS37B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	118,205,062 - 118,235,844 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	118,205,002 - 118,235,768 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666037	127,076,961 - 127,109,352 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Vps37b
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	16	29,828,833 - 29,856,682 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Vps37b
289 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	184
Count of miRNA genes:	134
Interacting mature miRNAs:	145
Transcripts:	ENSRNOT00000001445
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	24805022	52308831	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	11200494	52308831	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
8693635	Alc28	Alcohol consumption QTL 28	2.7	0.439	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	28717718	50386405	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	25989355	52308831	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	3489416	48489416	Rat
1331739	Hrtrt14	Heart rate QTL 14	3.56232		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	12	1	38687564	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	18473041	52308831	Rat
1300162	Bp188	Blood pressure QTL 188	3.19		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	37764145	51558799	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200497	52308831	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	15264248	52308831	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	11743528	52308831	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
2293684	Bmd26	Bone mineral density QTL 26	4.4	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	12	1	38635130	Rat
70169	Eae13	Experimental allergic encephalomyelitis QTL 13		0.032	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	12	29775522	42298555	Rat
1600386	Calcic2	Intracellular calcium level QTL 2		0.001	platelet physiology trait (VT:0005464)	platelet intracellular calcium level (CMO:0000922)	12	33700432	46784661	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	17464979	46784661	Rat
1556747	Calcic1	Intracellular calcium level QTL 1		3.6	platelet calcium amount (VT:0010500)	platelet intracellular calcium level (CMO:0000922)	12	33700432	46784661	Rat
1300175	Cm5	Cardiac mass QTL 5	3.78		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	33700432	51558799	Rat
631829	Alc6	Alcohol consumption QTL 6	4.7		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	34243475	43352593	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	16187438	52308831	Rat
8693658	Alc33	Alcohol consumption QTL 33	2.1	0.68	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	28717718	49212240	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	16135029	52308831	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	51213550	Rat
1331763	Wbc2	White blood cell count QTL 2	3.162		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	12	11200494	52308831	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	11200494	52308831	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	41361854	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	2747694	47747694	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	18473041	52308831	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	3087180	48087180	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7243862	Mcs30	Mammary carcinoma susceptibility QTL 30	8.62		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	12	5633306	50633306	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	16135029	52308831	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat

Markers in Region

RH141742

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	32,587,410 - 32,587,604 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	38,021,765 - 38,021,958	NCBI	Rnor6.0
Rnor_5.0	12	39,892,762 - 39,892,955	UniSTS	Rnor5.0
RGSC_v3.4	12	33,711,472 - 33,711,665	UniSTS	RGSC3.4
Celera	12	34,274,979 - 34,275,172	UniSTS
RH 3.4 Map	12	571.8	UniSTS
Cytogenetic Map	12	q15	UniSTS

RH134112

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	32,588,817 - 32,588,985 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	38,023,172 - 38,023,339	NCBI	Rnor6.0
Rnor_5.0	12	39,894,169 - 39,894,336	UniSTS	Rnor5.0
RGSC_v3.4	12	33,712,879 - 33,713,046	UniSTS	RGSC3.4
Celera	12	34,276,386 - 34,276,553	UniSTS
RH 3.4 Map	12	575.7	UniSTS
Cytogenetic Map	12	q15	UniSTS

RH139316

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	32,588,221 - 32,588,391 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	38,022,576 - 38,022,745	NCBI	Rnor6.0
Rnor_5.0	12	39,893,573 - 39,893,742	UniSTS	Rnor5.0
RGSC_v3.4	12	33,712,283 - 33,712,452	UniSTS	RGSC3.4
Celera	12	34,275,790 - 34,275,959	UniSTS
Cytogenetic Map	12	q15	UniSTS

BF388086

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	32,561,315 - 32,561,470 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	37,986,059 - 37,986,213	NCBI	Rnor6.0
Rnor_5.0	12	39,858,422 - 39,858,576	UniSTS	Rnor5.0
RGSC_v3.4	12	33,685,627 - 33,685,781	UniSTS	RGSC3.4
Celera	12	34,249,401 - 34,249,555	UniSTS
RH 3.4 Map	12	571.9	UniSTS
Cytogenetic Map	12	q15	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	162	91	90	59	92	59	6	356	192	11	141	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001105928	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006249332	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000001445 ⟹ ENSRNOP00000001445

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	38,220,959 - 38,249,935 (+)	Ensembl
mRatBN7.2 Ensembl	12	32,560,065 - 32,589,014 (+)	Ensembl
Rnor_6.0 Ensembl	12	37,984,790 - 38,023,368 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104349 ⟹ ENSRNOP00000088871

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	38,220,959 - 38,248,314 (+)	Ensembl
mRatBN7.2 Ensembl	12	32,560,047 - 32,587,393 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000108720 ⟹ ENSRNOP00000089595

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	38,246,470 - 38,249,935 (+)	Ensembl
mRatBN7.2 Ensembl	12	32,584,990 - 32,589,012 (+)	Ensembl

RefSeq Acc Id:

NM_001105928 ⟹ NP_001099398

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	38,220,973 - 38,249,935 (+)	NCBI
mRatBN7.2	12	32,560,047 - 32,589,014 (+)	NCBI
Rnor_6.0	12	37,984,790 - 38,023,368 (+)	NCBI
Rnor_5.0	12	39,857,153 - 39,894,366 (+)	NCBI
RGSC_v3.4	12	33,684,358 - 33,713,075 (+)	RGD
Celera	12	34,248,132 - 34,276,582 (+)	RGD

Sequence:

show sequence

GAGCTTGGCGGCCGGAGCGGCGGCGGCGGCCGAGTGGCGGGATGGCGGGCGCCGTGAGCGAGGC
GCGCTTCGCGGGGCTGTCGCTGATGCAGCTGCACGAGCTGCTGGAGGACGATGCCCAGCTCGGC
GACATGGTGCGGGGGATGGAGGAGACGCAGACTGTTCAGCATAACAAAGAGATGACACTGGCTA
GCAACCGGAGCCTGGCAGAGGGAAACCTTTTGTACCAGCCCCAACTGGATGCTCAGAAGGCGCG
CCTGACCCAAAAATACCAGGAACTCCAGGTTCTCTTTGAGGCCTATCAGATAAAGAAGACCAAA
CTAGATAAACAATCTAACAGCGCTTCCTTGGAGACGCTGTTAGCGCTTCTTCAAGCAGAAGGGG
CCAAGATTGAGGAAGACACTGAGAACATGGCAGAGAAGTTTCTGGATGGAGAGCTTCCTCTAGA
TGCCTTTATTGATGTCTACCAGAGCAAGCGGAAGCTGGCACACATACGACGTGTCAAAGTGGAG
AAGCTCCAGGAGCTGGTGCTGAAGGGACAGAGACTCCCACAAGCCGGGGTCCCACTTCCACCCC
GGGTGCCCGAGCCATCACCTGCCACCGCCCTTCCCTACCCACCTCTGGAGGCCACTGGGCTCCC
TTCTGTTGTGCCTCGGCGCATCCCCCCACCTCCACCCCCGGTGCCTGCAGGACACGTAGCCACC
CCGTTCACTGCTGCCATGGGCTCAGGACAGGCTTCTGCGTACCCAGGATTACAGTGCCCACCTC
TGCCTCCCAGAGTGGGCCTCCCCTCTCAGCAAGGATTCTCCACACAGTTGGTGTCACCGTACCC
ACCAGCCCTGCCCCAGAGACCCCCTCCACGGATGGCTCCTCACCAGCCAGGCTTCATCCTGCAG
TGAGCTCAGGGGCCTACTCTTCCTTCAAGACATCCTCTGCCTGCCGTGCCGAGCTCTGCACACA
CAGGCTGTGAGGTTCAGCTTCTGGGCCAAGGGCTTGGATGCCCTGGGCCAGTGTGTCCGTCTGA
CTTTAGAACTGTAGGTCCGTGGTAAGTAAGTAATAGAGAGCCGGTTTTGTGCACCAAGGGAGCT
CTGTTTGTACCAGGCCAGTCAGCATCACATCGGTCTGTGTTCTGGGTGTGATTTCTGAGTGTCT
AGTGTTGTTGATGGACTCGTGCATTTGGAAAGATAAACCTCCCCCCTCCAATTTAGAATCATGG
CCCTCCTGTTGCAGCTTTATTTAATAAGCATGATTAATTATGTCTGTTTTATTTTCAAGTCTTG
GCCCACCAGCTGCTGTGGCACTAGTAAAGGCTGGTCTACAGCGGCCAGCCGGAGCGTGTGCCGG
TGCCCAGGCCATGCTGGGCAGCTATGCTGTTCATTGAATCTGTGCAGGGCAGGGCATCACAGTG
ACCTCGTGTTCCCGCCAAGCTGGATGCTTTCATGGTTCCAAGTCACAGGCAGAATTTGCACTTG
GCTGCTGTGTGCAGAGGCCAGGAGAGCTGTGGCCCTGGGGGTGAGGCCAGTGTGTTGCACAGTA
CAGCCCTCAGCCCTCCCCTCACACCGTCAAGCCGCATGACGGTTTCTGTGAAAAAAATACTCAG
TGTTTTTACTACACTTGTAATTTTCCTGTTTTATATTTCAAAAGAAAACTTTTTTGACACTCTC
AAGACCATTCAGGGAAACTTTTTTAAAAATGCAGATAGACTGTTTTGAGTTGGTTAAAAATGCA
GATTTATTGAGTGCCGCTTCCTGTCAGGCGAGCAGTGCGTGGTCACATCCGTCCGTGGCCGTGC
TGTGCCTTAGCTTCACCTGGTGCCAGGGCTCAGATGCCTGCAGCGTGCCAGCCACAGCTGCCCT
ACAGAGCCGTTAGGCGGGGCCTAACAGGCCACATCACTTTGTGACAGGTCAGAAAGGGTCCCTC
CTCCTCCAACCAGGATGACTTAGGCAGCTGGCTGTGCTGCAGGTGTCGGCCAAGGCACGGAATG
GGTTTGGGGAAGGCCCACCCCACAGGATTGGCGGCAGCAGCTCCGTCCTCTCTGGGACCTCATC
TGCAGGTGCCCCATGTGCAGAGTTCCCAAGGCCCAGCCGGGGAGGGGCAGTCCCACACCTGTTC
TGCGAAGAGGGCTGCGCGACTGTTGGTAGAACTCAGAACCCCCTCCACCCTGCCAGCTGGCTGC
AGCCCAGGGCAACAGTCAAGGCAGCGCTGGTTAGAGCCTGTCCCAGCTGGGCCACCGGCAGGAC
CATCAGCCTTTGTCCCCAAGTCATCCTATATTCCTCATCACGGATTTGGACTCTGTACCCTACT
GGAACTATTCTGTAGAGACAAAGCTGTATGTGCCACCTCAATACCTCTGCCACCAGCTGCCACC
AGGAACGCCCACTGCCCAGTCCTGGGCTGCAGCCACATGGGAGCTCCAGGTGGATGTAGGAAAG
GGGCTGCCAGGCTGACCTTGCCGGGCCAGAGCTGGCACCGTGGCTGTAAAGGTGTAGACCTCTT
AATAAATTGAGAATTATTAATTTC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001099398	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM13607	(Get FASTA)	NCBI Sequence Viewer
	EDM13608	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000001445
	ENSRNOP00000001445.6
	ENSRNOP00000088871.1
	ENSRNOP00000089595.1

RefSeq Acc Id:

NP_001099398 ⟸ NM_001105928

- UniProtKB:

D3ZU64 (UniProtKB/TrEMBL), A6J118 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAGAVSEARFAGLSLMQLHELLEDDAQLGDMVRGMEETQTVQHNKEMTLASNRSLAEGNLLYQP
QLDAQKARLTQKYQELQVLFEAYQIKKTKLDKQSNSASLETLLALLQAEGAKIEEDTENMAEKF
LDGELPLDAFIDVYQSKRKLAHIRRVKVEKLQELVLKGQRLPQAGVPLPPRVPEPSPATALPYP
PLEATGLPSVVPRRIPPPPPPVPAGHVATPFTAAMGSGQASAYPGLQCPPLPPRVGLPSQQGFS
TQLVSPYPPALPQRPPPRMAPHQPGFILQ

hide sequence

Ensembl Acc Id:

ENSRNOP00000001445 ⟸ ENSRNOT00000001445

Ensembl Acc Id:

ENSRNOP00000088871 ⟸ ENSRNOT00000104349

Ensembl Acc Id:

ENSRNOP00000089595 ⟸ ENSRNOT00000108720

Protein Domains

VPS37 C-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZU64-F1-model_v2	AlphaFold	D3ZU64	1-285	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698619

Promoter ID:

EPDNEW_R9144

Type:

initiation region

Name:

Vps37b_1

Description:

VPS37B, ESCRT-I subunit

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	37,984,792 - 37,984,852	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1304576	AgrOrtholog
BioCyc Gene	G2FUF-19333	BioCyc
Ensembl Genes	ENSRNOG00000001086	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000001445	ENTREZGENE
	ENSRNOT00000001445.7	UniProtKB/TrEMBL
	ENSRNOT00000104349.2	UniProtKB/TrEMBL
	ENSRNOT00000108720.2	UniProtKB/TrEMBL
Gene3D-CATH	1.10.287.660	UniProtKB/TrEMBL
InterPro	Helix_hairpin_bin_sf	UniProtKB/TrEMBL
	Mod_r	UniProtKB/TrEMBL
KEGG Report	rno:288659	UniProtKB/TrEMBL
NCBI Gene	288659	ENTREZGENE
PANTHER	VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 37	UniProtKB/TrEMBL
	VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 37B	UniProtKB/TrEMBL
Pfam	Mod_r	UniProtKB/TrEMBL
PhenoGen	Vps37b	PhenoGen
PROSITE	VPS37_C	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000001086	RatGTEx
UniProt	A0A8I6A711_RAT	UniProtKB/TrEMBL
	A0A8I6ACY9_RAT	UniProtKB/TrEMBL
	A6J118	ENTREZGENE, UniProtKB/TrEMBL
	A6J119_RAT	UniProtKB/TrEMBL
	D3ZU64	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-04-02	Vps37b	VPS37B subunit of ESCRT-I	Vps37b	VPS37B, ESCRT-I subunit	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-03-08	Vps37b	VPS37B, ESCRT-I subunit	Vps37b	vacuolar protein sorting 37 homolog B (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-25	Vps37b	vacuolar protein sorting 37 homolog B (S. cerevisiae)	Vps37b	vacuolar protein sorting 37B (yeast)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Vps37b	vacuolar protein sorting 37B (yeast)	Vps37b_predicted	vacuolar protein sorting 37B (yeast) (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-30	Vps37b_predicted	vacuolar protein sorting 37B (yeast) (predicted)	RGD1304576_predicted	similar to Hypothetical protein MGC25614 (predicted)	Symbol and Name updated	1299863	APPROVED
2005-01-20	RGD1304576_predicted	similar to Hypothetical protein MGC25614 (predicted)	LOC288659_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC288659_predicted	similar to Hypothetical protein MGC25614 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Annotations - KEGG (archival)