Advanced Search (OLGA)

Gene: Tbc1d20 (TBC1 domain family, member 20) Rattus norvegicus

Analyze

Symbol:

Tbc1d20

Name:

TBC1 domain family, member 20

RGD ID:

1303293

Description:

Predicted to enable GTPase activator activity and small GTPase binding activity. Predicted to be involved in several processes, including COPII-coated vesicle cargo loading; host-mediated activation of viral genome replication; and positive regulation by virus of viral protein levels in host cell. Predicted to act upstream of or within several processes, including acrosome assembly; lens fiber cell morphogenesis; and seminiferous tubule development. Predicted to be located in Golgi membrane; endoplasmic reticulum; and nuclear membrane. Predicted to be active in endoplasmic reticulum membrane. Human ortholog(s) of this gene implicated in Warburg micro syndrome 4. Orthologous to human TBC1D20 (TBC1 domain family member 20); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

MGC94895; similar to chromosome 20 open reading frame 140; TBC1 domain family member 20

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TBC1D20 (TBC1 domain family member 20)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Tbc1d20 (TBC1 domain family, member 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tbc1d20 (TBC1 domain family member 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TBC1D20 (TBC1 domain family member 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TBC1D20 (TBC1 domain family member 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tbc1d20 (TBC1 domain family member 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TBC1D20 (TBC1 domain family member 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TBC1D20 (TBC1 domain family member 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tbc1d20 (TBC1 domain family member 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Tbc1d20 (TBC1 domain family member 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	TBC1D20 (TBC1 domain family member 20)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Tbc1d20 (TBC1 domain family, member 20)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tbc1d20 (TBC1 domain family, member 20)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG17883	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	GYP8	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	tbc-20	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	tbc1d20.1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	161,228,699 - 161,247,319 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	161,228,785 - 161,247,316 (+)	Ensembl				GRCr8
mRatBN7.2	3	140,768,537 - 140,787,010 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	140,768,537 - 140,785,121 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	144,673,328 - 144,690,001 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	153,257,161 - 153,273,834 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	150,997,769 - 151,014,273 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	147,772,006 - 147,790,946 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	147,772,165 - 147,789,158 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	154,120,296 - 154,137,199 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	142,623,713 - 142,640,197 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	139,520,860 - 139,537,468 (+)	NCBI		Celera
RGSC_v3.1	3	142,529,285 - 142,545,770 (+)	NCBI
Cytogenetic Map	3	q41	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Warburg micro syndrome (ISO)

Warburg micro syndrome 4 (ISO,ISS)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,4'-trichlorobiphenyl (ISO)

2,6-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

all-trans-retinoic acid (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

caffeine (ISO)

chlorpyrifos (ISO)

cocaine (EXP)

cyclosporin A (ISO)

Dibutyl phosphate (ISO)

endosulfan (EXP)

fenthion (ISO)

folic acid (ISO)

formaldehyde (ISO)

furan (EXP)

inulin (ISO)

leflunomide (ISO)

methidathion (ISO)

nickel sulfate (ISO)

nitrates (ISO)

paracetamol (ISO)

PCB138 (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

rac-lactic acid (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

tetrachloromethane (EXP)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

acrosome assembly (ISO)

camera-type eye development (ISO)

COPII-coated vesicle cargo loading (ISO)

endoplasmic reticulum to Golgi vesicle-mediated transport (ISO)

Golgi organization (ISO)

host-mediated activation of viral genome replication (ISO)

lens development in camera-type eye (ISO)

lens fiber cell morphogenesis (ISO)

lipid droplet organization (ISO)

male gonad development (ISO)

positive regulation by virus of viral protein levels in host cell (ISO)

positive regulation of ER to Golgi vesicle-mediated transport (ISO)

positive regulation of GTPase activity (ISO)

regulation of cilium assembly (ISO)

seminiferous tubule development (ISO)

spermatogenesis (ISO)

vesicle-mediated transport (IEA)

Cellular Component

endoplasmic reticulum (ISO)

endoplasmic reticulum membrane (ISO)

Golgi membrane (ISO)

nuclear membrane (ISO)

Molecular Function

GTPase activator activity (IEA,ISO)

protein binding (ISO)

small GTPase binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:14757819	PMID:17646400	PMID:17684057	PMID:17686842	PMID:21680502	PMID:22491470	PMID:24239381

Genomics

Comparative Map Data

Tbc1d20
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	161,228,699 - 161,247,319 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	161,228,785 - 161,247,316 (+)	Ensembl				GRCr8
mRatBN7.2	3	140,768,537 - 140,787,010 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	140,768,537 - 140,785,121 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	144,673,328 - 144,690,001 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	153,257,161 - 153,273,834 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	150,997,769 - 151,014,273 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	147,772,006 - 147,790,946 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	147,772,165 - 147,789,158 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	154,120,296 - 154,137,199 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	142,623,713 - 142,640,197 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	139,520,860 - 139,537,468 (+)	NCBI		Celera
RGSC_v3.1	3	142,529,285 - 142,545,770 (+)	NCBI
Cytogenetic Map	3	q41	NCBI

TBC1D20
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	435,480 - 462,533 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	423,596 - 462,566 (-)	Ensembl			hg38	GRCh38
GRCh37	20	416,124 - 443,177 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	364,124 - 391,187 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	20	364,125 - 391,147	NCBI
Celera	20	510,958 - 538,015 (-)	NCBI		Celera
Cytogenetic Map	20	p13	NCBI
HuRef	20	367,459 - 394,130 (-)	NCBI		HuRef
CHM1_1	20	416,126 - 443,204 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	20	479,231 - 506,260 (-)	NCBI		T2T-CHM13v2.0

Tbc1d20
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	152,135,745 - 152,155,914 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	152,135,748 - 152,155,916 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	2	152,293,826 - 152,313,994 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	152,293,828 - 152,313,996 (+)	Ensembl			mm10	GRCm38
MGSCv37	2	152,119,608 - 152,138,326 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	2	151,985,313 - 152,004,031 (+)	NCBI		MGSCv36	mm8
Celera	2	158,107,984 - 158,126,733 (+)	NCBI		Celera
Cytogenetic Map	2	G3	NCBI
cM Map	2	74.83	NCBI

Tbc1d20
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955597	291,541 - 314,292 (-)	Ensembl
ChiLan1.0	NW_004955597	291,541 - 313,799 (-)	NCBI	ChiLan1.0	ChiLan1.0

TBC1D20
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	1,524,951 - 1,551,103 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	1,521,783 - 1,547,931 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	644,646 - 670,860 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	414,066 - 429,189 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	414,066 - 431,032 (-)	Ensembl			panPan2	panpan1.1

TBC1D20
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	20,400,647 - 20,419,652 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	20,400,791 - 20,419,655 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	20,054,600 - 20,073,599 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	21,093,909 - 21,112,923 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	21,093,893 - 21,112,920 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	20,368,969 - 20,388,211 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	20,475,176 - 20,494,176 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	20,905,480 - 20,924,706 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Tbc1d20
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	169,603,422 - 169,624,377 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936485	18,034,732 - 18,055,767 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936485	18,034,776 - 18,055,741 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TBC1D20
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	34,760,347 - 34,779,701 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	17	34,760,379 - 34,778,301 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	39,584,314 - 39,589,765 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TBC1D20
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	56,065,975 - 56,093,521 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	56,066,042 - 56,094,333 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666078	7,861,563 - 7,886,879 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tbc1d20
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624741	1,525,569 - 1,550,806 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624741	1,525,739 - 1,550,774 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Tbc1d20
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	5	131,621,061 - 131,637,182 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Tbc1d20
99 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	107
Count of miRNA genes:	95
Interacting mature miRNAs:	101
Transcripts:	ENSRNOT00000008713
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
12879876	Bw182	Body weight QTL 182		0.003	body mass (VT:0001259)	body weight (CMO:0000012)	3	141555229	186555229	Rat
2301411	Bp320	Blood pressure QTL 320		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	141555229	186555229	Rat
1582233	Insul10	Insulin level QTL 10	5.4	0.0015	blood insulin amount (VT:0001560)	serum insulin level times blood glucose level (CMO:0002040)	3	133259579	178259579	Rat
12879872	Cm97	Cardiac mass QTL 97		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	141555229	186555229	Rat
12879873	Cm96	Cardiac mass QTL 96		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	141555229	186555229	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	151075912	189428310	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	129154923	182114333	Rat
12879874	Cm98	Cardiac mass QTL 98		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	141555229	186555229	Rat
12879875	Kidm64	Kidney mass QTL 64		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	141555229	186555229	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	51581665	184004958	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	67641776	167835660	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	133134628	178134628	Rat
1582213	Insul6	Insulin level QTL 6	3.7	0.0009	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	3	155759447	189428310	Rat
1300173	Rf11	Renal function QTL 11	3.38		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	141508991	166376254	Rat
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	152055202	189428310	Rat
10755461	Coatc16	Coat color QTL 16			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	3	142898802	187898802	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	79649560	177741895	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	145335553	189428310	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	117537367	162537367	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	125116475	170116475	Rat
1582256	Insul9	Insulin level QTL 9	4.4	0.0016	blood insulin amount (VT:0001560)	absolute change in serum insulin level (CMO:0002038)	3	155759447	189428310	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	139299381	184299381	Rat
5686842	Rf59	Renal function QTL 59			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	3	122395989	167395989	Rat
1300159	Kidm4	Kidney mass QTL 4	3.83		kidney mass (VT:0002707)	right kidney wet weight to body weight ratio (CMO:0001953)	3	141508991	177728348	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	131036586	176036586	Rat
631673	Iddm13	Insulin dependent diabetes mellitus QTL 13	1.3	0.663	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	3	137114333	182114333	Rat
1582248	Insul7	Insulin level QTL 7	3.9	0.0041	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	3	155759447	189428310	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	131036586	176036586	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	98651826	167012663	Rat
1578666	Vnigr1	Vascular neointimal growth QTL 1	4.6		artery morphology trait (VT:0002191)	artery lumen area (CMO:0001409)	3	151075912	189428310	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	151075912	189428310	Rat
12879871	Am7	Aortic mass QTL 7		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	141555229	186555229	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	144575244	189428310	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	160357340	167835660	Rat

Markers in Region

BE118229

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	140,782,217 - 140,782,367 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	147,786,155 - 147,786,304	NCBI	Rnor6.0
Rnor_5.0	3	154,134,296 - 154,134,445	UniSTS	Rnor5.0
RGSC_v3.4	3	142,637,294 - 142,637,443	UniSTS	RGSC3.4
Celera	3	139,534,565 - 139,534,714	UniSTS
RH 3.4 Map	3	1277.5	UniSTS
Cytogenetic Map	3	q41	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
23	13	85	213	91	90	59	159	59	6	493	287	22	191	116	124	31	34	34

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001004281	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008762348	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105482	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105483	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105485	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063284174	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063284175	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063284176	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC079383	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474050	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000008713 ⟹ ENSRNOP00000008713

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	161,228,785 - 161,247,316 (+)	Ensembl
mRatBN7.2 Ensembl	3	140,768,537 - 140,785,121 (+)	Ensembl
Rnor_6.0 Ensembl	3	147,772,165 - 147,789,158 (+)	Ensembl

RefSeq Acc Id:

NM_001004281 ⟹ NP_001004281

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	161,228,848 - 161,245,430 (+)	NCBI
mRatBN7.2	3	140,768,537 - 140,785,121 (+)	NCBI
Rnor_6.0	3	147,772,155 - 147,789,058 (+)	NCBI
Rnor_5.0	3	154,120,296 - 154,137,199 (+)	NCBI
RGSC_v3.4	3	142,623,713 - 142,640,197 (+)	RGD
Celera	3	139,520,860 - 139,537,468 (+)	RGD

Sequence:

show sequence

CCGCGCGTCAGGCTCCGCCGCCAGCCGGGGCTCGGGCTGGGGCCCGGGCCCCCGGGGATGGCCC
TCCGGCCCTCAGAGGGCGACGGCTCCGCCGGCCGCTGGAACCGCGGCTCAGGGAAGGCAGACTT
TAATGCCAAAAGGAAAAAGAAGGTGGCGGAGATACACCAAGCTCTGAACAGTGATCCCACCGAT
GTGGCTGCCCTCCGACGAATGGCTATCAGCGAGGGCGGGCTCCTGACTGATGAGATCAGGTGCC
AAGTATGGCCTAAGCTCCTCAACGTCAACACCGATGAGCCACCGCCTATGTCAAGGAAGGATCT
TCGAGACATGAGCAAGGACTACCAGCAAGTGCTGCTGGACGTCAGGCGGTCTCTTCGGCGCTTC
CCTCCGGGCATGCCAGATGAGCAGAGAGAAGGGCTCCAGGAAGAGCTAATCGATATCATCCTCC
TCGTCTTGGATCGAAACCCTCAGCTCCACTACTACCAGGGCTACCATGACATTGTGGTCACTTT
TCTGCTGGTGGTGGGCGAGAGGCTGGCAACATCCCTGGTAGAAAAATTGTCCACCCACCACCTC
AGGGATTTCATGGATCCCACAATGGACAACACCAAGCACATCTTAAATTACCTGATGCCCATCA
TTGACCAAGTGAACCCAGAACTTCATGACTTCATGCAGAGTGCTGAGGTGGGGACCATCTTCGC
CCTCAGCTGGCTTATCACCTGGTTTGGGCACGTCCTGTTGGACTTCAGGCATGTGGTGAGGTTA
TACGACTTCTTCCTGGCCTGCCACCCACTCATGCCTATTTACTTTGCAGCTGTGATCGTGCTGT
ACCGGGAGCAGGAAGTGCTGGACTGTGACTGTGACATGGCCTCTGTTCACCACCTGTTGTCCCA
GATCCCTCAGGACCTGCCCTATGAGACGCTCATCAGCAGAGCAGGAGACCTCTTTGTTCAGTTT
CCCCCTTCTGAACTGGCAAGGGAGGCGGCTGCTCAGCAGGAGGCGGAGAGAACGGCAGCCTCTA
CTTTCAAAGACTTTGAGCTGGCGTCAACTCAGCAGAGGCCAGACATGGTGCTGCGGCAGCGGTT
TCGGGGACTTCTGAGGCCTGAGGCTCGAACAAAAGATGTCCTGACCAAACCAAGGACCAACCGC
TTTGTAAAACTGGCAGTGATGGGGCTGACGGTGGCCCTAGGAGCAGCAGCACTGGCAGTGGTGA
AGAGTGCCCTGGAGTGGGCCCCTAAGTTCCAGCTGCAGCTGTTCCCCTAAACTCAGCTCAATCA
GCCACTTCCTCGCCAGTGCACCAAGCTCTCCCCATTTCCGGAAAGAGGGTGCAATTGCTGTGAT
TAAAGGGTTTCTGTCAGGGGAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039105482 ⟹ XP_038961410

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	161,229,001 - 161,247,319 (+)	NCBI
mRatBN7.2	3	140,768,675 - 140,787,010 (+)	NCBI

RefSeq Acc Id:

XM_039105483 ⟹ XP_038961411

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	161,228,998 - 161,247,319 (+)	NCBI
mRatBN7.2	3	140,768,673 - 140,787,010 (+)	NCBI

RefSeq Acc Id:

XM_039105485 ⟹ XP_038961413

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	161,228,995 - 161,247,319 (+)	NCBI
mRatBN7.2	3	140,768,671 - 140,784,996 (+)	NCBI

RefSeq Acc Id:

XM_063284174 ⟹ XP_063140244

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	161,228,699 - 161,247,319 (+)	NCBI

RefSeq Acc Id:

XM_063284175 ⟹ XP_063140245

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	161,229,658 - 161,247,319 (+)	NCBI

RefSeq Acc Id:

XM_063284176 ⟹ XP_063140246

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	161,228,699 - 161,247,319 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001004281	(Get FASTA)	NCBI Sequence Viewer
	XP_038961410	(Get FASTA)	NCBI Sequence Viewer
	XP_038961411	(Get FASTA)	NCBI Sequence Viewer
	XP_038961413	(Get FASTA)	NCBI Sequence Viewer
	XP_063140244	(Get FASTA)	NCBI Sequence Viewer
	XP_063140245	(Get FASTA)	NCBI Sequence Viewer
	XP_063140246	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79383	(Get FASTA)	NCBI Sequence Viewer
	EDL86079	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000008713
	ENSRNOP00000008713.3

RefSeq Acc Id:

NP_001004281 ⟸ NM_001004281

- UniProtKB:

Q6AXR1 (UniProtKB/TrEMBL), A6KHM6 (UniProtKB/TrEMBL), F7EVY6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MALRPSEGDGSAGRWNRGSGKADFNAKRKKKVAEIHQALNSDPTDVAALRRMAISEGGLLTDEI
RCQVWPKLLNVNTDEPPPMSRKDLRDMSKDYQQVLLDVRRSLRRFPPGMPDEQREGLQEELIDI
ILLVLDRNPQLHYYQGYHDIVVTFLLVVGERLATSLVEKLSTHHLRDFMDPTMDNTKHILNYLM
PIIDQVNPELHDFMQSAEVGTIFALSWLITWFGHVLLDFRHVVRLYDFFLACHPLMPIYFAAVI
VLYREQEVLDCDCDMASVHHLLSQIPQDLPYETLISRAGDLFVQFPPSELAREAAAQQEAERTA
ASTFKDFELASTQQRPDMVLRQRFRGLLRPEARTKDVLTKPRTNRFVKLAVMGLTVALGAAALA
VVKSALEWAPKFQLQLFP

hide sequence

Ensembl Acc Id:

ENSRNOP00000008713 ⟸ ENSRNOT00000008713

RefSeq Acc Id:	XP_038961413 ⟸ XM_039105485
- Peptide Label:	isoform X5

RefSeq Acc Id:	XP_038961411 ⟸ XM_039105483
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038961410 ⟸ XM_039105482
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063140244 ⟸ XM_063284174
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_063140246 ⟸ XM_063284176
- Peptide Label:	isoform X6

RefSeq Acc Id:	XP_063140245 ⟸ XM_063284175
- Peptide Label:	isoform X4

Protein Domains

Rab-GAP TBC

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6AXR1-F1-model_v2	AlphaFold	Q6AXR1	1-402	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692532

Promoter ID:

EPDNEW_R3057

Type:

initiation region

Name:

Tbc1d20_1

Description:

TBC1 domain family, member 20

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	147,772,114 - 147,772,174	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1303293	AgrOrtholog
BioCyc Gene	G2FUF-47278	BioCyc
Ensembl Genes	ENSRNOG00000005766	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000008713	ENTREZGENE
	ENSRNOT00000008713.6	UniProtKB/TrEMBL
Gene3D-CATH	1.10.8.1310	UniProtKB/TrEMBL
	Ypt/Rab-GAP domain of gyp1p, domain 3	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7111239	IMAGE-MGC_LOAD
InterPro	Rab-GTPase_TBC_sf	UniProtKB/TrEMBL
	RabGAP_TBC	UniProtKB/TrEMBL
	TBC20/Gyp8-like	UniProtKB/TrEMBL
KEGG Report	rno:362237	UniProtKB/TrEMBL
MGC_CLONE	MGC:94895	IMAGE-MGC_LOAD
NCBI Gene	362237	ENTREZGENE
PANTHER	PTHR20913	UniProtKB/TrEMBL
	TBC1 DOMAIN FAMILY MEMBER 20	UniProtKB/TrEMBL
Pfam	TBC	UniProtKB/TrEMBL
PhenoGen	Tbc1d20	PhenoGen
PROSITE	TBC_RABGAP	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000005766	RatGTEx
SMART	TBC	UniProtKB/TrEMBL
Superfamily-SCOP	RabGAP_TBC	UniProtKB/TrEMBL
UniProt	A0ABZ3NN82_RAT	UniProtKB/TrEMBL
	A6KHM6	ENTREZGENE, UniProtKB/TrEMBL
	F7EVY6	ENTREZGENE, UniProtKB/TrEMBL
	Q6AXR1	ENTREZGENE
UniProt Secondary	Q6AXR1	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Tbc1d20	TBC1 domain family, member 20	MGC94895	similar to chromosome 20 open reading frame 140	Symbol and Name updated	1299863	APPROVED
2005-09-30	MGC94895				Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM