Symbol:
Snupn
Name:
snurportin 1
RGD ID:
1303191
Description:
Predicted to enable RNA cap binding activity. Predicted to be involved in RNA import into nucleus; cytoskeleton organization; and protein tetramerization. Predicted to be located in cytosol; nucleoplasm; and plasma membrane. Predicted to be part of NLS-dependent protein nuclear import complex. Orthologous to human SNUPN (snurportin 1); PARTICIPATES IN RNA transport pathway; INTERACTS WITH 2,6-dinitrotoluene; bisphenol A; cadmium dichloride.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
MGC95000; RNA U transporter 1; RNA, U transporter 1; Rnut1; snurportin-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SNUPN (snurportin 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Snupn (snurportin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Snupn (snurportin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SNUPN (snurportin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SNUPN (snurportin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Snupn (snurportin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SNUPN (snurportin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SNUPN (snurportin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Snupn (snurportin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
SNUPN (snurportin 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Snupn (snurportin 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
snupn (snurportin 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
F23F1.5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Snup
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
snupn
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 66,242,940 - 66,286,651 (+) NCBI GRCr8 mRatBN7.2 8 57,347,412 - 57,388,345 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 57,348,130 - 57,380,912 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 62,871,545 - 62,904,309 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 61,150,388 - 61,183,151 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 59,014,829 - 59,047,594 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 61,614,798 - 61,654,809 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 61,615,650 - 61,648,390 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 60,184,262 - 60,224,290 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 60,694,018 - 60,726,694 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 60,713,071 - 60,745,743 (+) NCBI Celera 8 56,816,464 - 56,849,116 (+) NCBI Celera Cytogenetic Map 8 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Snupn Rat (-)-epigallocatechin 3-gallate multiple interactions ISO SNUPN (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of SNUPN mRNA CTD PMID:22079256 Snupn Rat 1,2-dimethylhydrazine multiple interactions ISO Snupn (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SNUPN mRNA CTD PMID:22206623 Snupn Rat 17alpha-ethynylestradiol increases expression ISO Snupn (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of SNUPN mRNA CTD PMID:17942748 Snupn Rat 17alpha-ethynylestradiol multiple interactions ISO Snupn (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SNUPN mRNA CTD PMID:17942748 Snupn Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Snupn (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Snupn Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Snupn (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Snupn Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Snupn (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SNUPN mRNA CTD PMID:17942748 Snupn Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Snupn (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SNUPN mRNA CTD PMID:21570461 Snupn Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of SNUPN mRNA CTD PMID:21346803 Snupn Rat 2-hydroxypropanoic acid decreases expression ISO SNUPN (Homo sapiens) 6480464 Lactic Acid results in decreased expression of SNUPN mRNA CTD PMID:30851411 Snupn Rat 2-methylcholine affects expression ISO SNUPN (Homo sapiens) 6480464 beta-methylcholine affects the expression of SNUPN mRNA CTD PMID:21179406 Snupn Rat 4,4'-sulfonyldiphenol increases expression ISO Snupn (Mus musculus) 6480464 bisphenol S results in increased expression of SNUPN mRNA CTD PMID:39298647 Snupn Rat all-trans-retinoic acid decreases expression ISO SNUPN (Homo sapiens) 6480464 Tretinoin results in decreased expression of SNUPN mRNA CTD PMID:33167477 Snupn Rat arsenous acid decreases expression ISO SNUPN (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of SNUPN mRNA CTD PMID:20458559 Snupn Rat benzo[a]pyrene increases expression ISO Snupn (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of SNUPN mRNA CTD PMID:22228805 Snupn Rat benzo[a]pyrene increases methylation ISO SNUPN (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of SNUPN promoter CTD PMID:27901495 Snupn Rat beta-lapachone increases expression ISO SNUPN (Homo sapiens) 6480464 beta-lapachone results in increased expression of SNUPN mRNA CTD PMID:38218311 Snupn Rat bis(2-ethylhexyl) phthalate increases expression ISO Snupn (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of SNUPN mRNA CTD PMID:34319233 Snupn Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SNUPN mRNA CTD PMID:25181051 more ... Snupn Rat bisphenol A decreases methylation ISO SNUPN (Homo sapiens) 6480464 bisphenol A results in decreased methylation of SNUPN gene CTD PMID:31601247 Snupn Rat bisphenol A decreases expression ISO Snupn (Mus musculus) 6480464 bisphenol A results in decreased expression of SNUPN mRNA CTD PMID:33221593 Snupn Rat bisphenol A decreases expression ISO SNUPN (Homo sapiens) 6480464 bisphenol A results in decreased expression of SNUPN protein CTD PMID:33376534 Snupn Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of SNUPN mRNA CTD PMID:33453195 Snupn Rat cadmium dichloride decreases expression ISO SNUPN (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of SNUPN mRNA CTD PMID:38568856 Snupn Rat caffeine decreases phosphorylation ISO SNUPN (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of SNUPN protein CTD PMID:35688186 Snupn Rat chlorpyrifos increases expression ISO Snupn (Mus musculus) 6480464 Chlorpyrifos results in increased expression of SNUPN mRNA CTD PMID:37019170 Snupn Rat chromium(6+) decreases expression ISO SNUPN (Homo sapiens) 6480464 chromium hexavalent ion results in decreased expression of SNUPN mRNA CTD PMID:30690063 Snupn Rat ciguatoxin CTX1B affects expression ISO Snupn (Mus musculus) 6480464 Ciguatoxins affects the expression of SNUPN mRNA CTD PMID:18353800 Snupn Rat copper(II) sulfate decreases expression ISO SNUPN (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of SNUPN mRNA CTD PMID:19549813 Snupn Rat coumarin decreases phosphorylation ISO SNUPN (Homo sapiens) 6480464 coumarin results in decreased phosphorylation of SNUPN protein CTD PMID:35688186 Snupn Rat diarsenic trioxide decreases expression ISO SNUPN (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of SNUPN mRNA CTD PMID:20458559 Snupn Rat Dibutyl phosphate affects expression ISO SNUPN (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of SNUPN mRNA CTD PMID:37042841 Snupn Rat dibutyl phthalate decreases expression ISO Snupn (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of SNUPN mRNA CTD PMID:17361019 Snupn Rat disodium selenite increases expression ISO SNUPN (Homo sapiens) 6480464 Sodium Selenite results in increased expression of SNUPN mRNA CTD PMID:18175754 Snupn Rat doxorubicin decreases expression ISO SNUPN (Homo sapiens) 6480464 Doxorubicin results in decreased expression of SNUPN mRNA CTD PMID:29803840 Snupn Rat epoxiconazole decreases expression ISO Snupn (Mus musculus) 6480464 epoxiconazole results in decreased expression of SNUPN mRNA CTD PMID:35436446 Snupn Rat folic acid multiple interactions ISO Snupn (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SNUPN mRNA CTD PMID:22206623 Snupn Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of SNUPN mRNA CTD PMID:33387578 Snupn Rat inulin multiple interactions ISO Snupn (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of SNUPN mRNA CTD PMID:36331819 Snupn Rat ivermectin decreases expression ISO SNUPN (Homo sapiens) 6480464 Ivermectin results in decreased expression of SNUPN protein CTD PMID:32959892 Snupn Rat manganese atom multiple interactions ISO SNUPN (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of SNUPN mRNA CTD PMID:39836092 Snupn Rat manganese(0) multiple interactions ISO SNUPN (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of SNUPN mRNA CTD PMID:39836092 Snupn Rat manganese(II) chloride multiple interactions ISO SNUPN (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of SNUPN mRNA CTD PMID:39836092 Snupn Rat methyl methanesulfonate decreases expression ISO SNUPN (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of SNUPN mRNA CTD PMID:23649840 Snupn Rat paracetamol decreases expression ISO SNUPN (Homo sapiens) 6480464 Acetaminophen results in decreased expression of SNUPN mRNA CTD PMID:29067470 Snupn Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of SNUPN mRNA CTD PMID:33387578 Snupn Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Snupn (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of SNUPN mRNA CTD PMID:36331819 Snupn Rat potassium chromate multiple interactions ISO SNUPN (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of SNUPN mRNA CTD PMID:22079256 Snupn Rat potassium chromate decreases expression ISO SNUPN (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of SNUPN mRNA CTD PMID:22079256 and PMID:22714537 Snupn Rat rac-lactic acid decreases expression ISO SNUPN (Homo sapiens) 6480464 Lactic Acid results in decreased expression of SNUPN mRNA CTD PMID:30851411 Snupn Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of SNUPN mRNA CTD PMID:34492290 Snupn Rat thiram decreases expression ISO SNUPN (Homo sapiens) 6480464 Thiram results in decreased expression of SNUPN mRNA CTD PMID:38568856 Snupn Rat triphenyl phosphate affects expression ISO SNUPN (Homo sapiens) 6480464 triphenyl phosphate affects the expression of SNUPN mRNA CTD PMID:37042841 Snupn Rat valproic acid decreases expression ISO SNUPN (Homo sapiens) 6480464 Valproic Acid results in decreased expression of SNUPN mRNA CTD PMID:29154799 Snupn Rat valproic acid affects expression ISO Snupn (Mus musculus) 6480464 Valproic Acid affects the expression of SNUPN mRNA CTD PMID:17292431
Imported Annotations - KEGG (archival)
(-)-epigallocatechin 3-gallate (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,6-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 2-methylcholine (ISO) 4,4'-sulfonyldiphenol (ISO) all-trans-retinoic acid (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) chlorpyrifos (ISO) chromium(6+) (ISO) ciguatoxin CTX1B (ISO) copper(II) sulfate (ISO) coumarin (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) disodium selenite (ISO) doxorubicin (ISO) epoxiconazole (ISO) folic acid (ISO) gentamycin (EXP) inulin (ISO) ivermectin (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methyl methanesulfonate (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) potassium chromate (ISO) rac-lactic acid (ISO) thioacetamide (EXP) thiram (ISO) triphenyl phosphate (ISO) valproic acid (ISO)
Snupn Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 66,242,940 - 66,286,651 (+) NCBI GRCr8 mRatBN7.2 8 57,347,412 - 57,388,345 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 57,348,130 - 57,380,912 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 62,871,545 - 62,904,309 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 61,150,388 - 61,183,151 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 59,014,829 - 59,047,594 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 61,614,798 - 61,654,809 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 61,615,650 - 61,648,390 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 60,184,262 - 60,224,290 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 60,694,018 - 60,726,694 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 60,713,071 - 60,745,743 (+) NCBI Celera 8 56,816,464 - 56,849,116 (+) NCBI Celera Cytogenetic Map 8 q24 NCBI
SNUPN Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 75,598,086 - 75,626,461 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 75,598,083 - 75,626,469 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 75,890,427 - 75,918,802 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 73,677,479 - 73,705,774 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 73,677,479 - 73,705,132 NCBI Celera 15 52,816,555 - 52,843,715 (-) NCBI Celera Cytogenetic Map 15 q24.2 NCBI HuRef 15 52,648,179 - 52,675,001 (-) NCBI HuRef CHM1_1 15 76,009,938 - 76,038,212 (-) NCBI CHM1_1 T2T-CHM13v2.0 15 73,468,790 - 73,497,167 (-) NCBI T2T-CHM13v2.0
Snupn Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 56,855,158 - 56,893,545 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 56,858,162 - 56,890,490 (+) Ensembl GRCm39 Ensembl GRCm38 9 56,949,419 - 56,986,261 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 56,950,878 - 56,983,206 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 56,798,731 - 56,831,006 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 56,749,061 - 56,781,336 (+) NCBI MGSCv36 mm8 Celera 9 54,176,012 - 54,208,260 (+) NCBI Celera Cytogenetic Map 9 B NCBI cM Map 9 30.57 NCBI
Snupn Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955450 2,691,617 - 2,722,150 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955450 2,701,496 - 2,720,971 (+) NCBI ChiLan1.0 ChiLan1.0
SNUPN Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 64,793,879 - 64,821,585 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 68,957,744 - 68,985,777 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 54,508,586 - 54,536,301 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 74,102,744 - 74,151,065 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 74,102,753 - 74,126,511 (-) Ensembl panpan1.1 panPan2
SNUPN Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 30 38,401,016 - 38,422,885 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 30 38,401,192 - 38,432,686 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 30 38,331,424 - 38,354,995 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 30 38,606,443 - 38,630,072 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 30 38,606,449 - 38,629,967 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 30 38,558,080 - 38,581,589 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 30 38,602,795 - 38,626,664 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 30 38,840,276 - 38,863,881 (-) NCBI UU_Cfam_GSD_1.0
Snupn Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 116,525,429 - 116,545,094 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936471 34,373,468 - 34,393,692 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936471 34,373,492 - 34,393,666 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SNUPN Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 58,038,995 - 58,071,243 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 58,038,917 - 58,065,972 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 62,728,090 - 62,755,132 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SNUPN
Snupn
.
Predicted Target Of
Count of predictions: 50 Count of miRNA genes: 42 Interacting mature miRNAs: 50 Transcripts: ENSRNOT00000007261 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1298065 Scl16 Serum cholesterol level QTL 16 3.8 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30856404 75856404 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 1298079 Activ2 Activity QTL 2 9.5 0.000001 voluntary movement trait (VT:0003491) rearing measurement (CMO:0001515) 8 41866876 86866876 Rat 11556286 Cm81 Cardiac mass QTL 81 0.01 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 30848154 61290444 Rat 70161 Bp62 Blood pressure QTL 62 2.9 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 42692684 90165460 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 1582222 Epfw2 Epididymal fat weight QTL 2 3.2 0.0005 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 8 31737729 76737729 Rat 61464 Niddm11 Non-insulin dependent diabetes mellitus QTL 11 3.1 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 35582032 80582032 Rat 4889938 Bss89 Bone structure and strength QTL 89 3.8 tibia size trait (VT:0100001) tibia cortical bone volume (CMO:0001725) 8 50095249 82460899 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 1300146 Rf17 Renal function QTL 17 2.9 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 8 28242912 73242912 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2313088 Bss75 Bone structure and strength QTL 75 3.1 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 8 30848154 82460899 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 724514 Uae15 Urinary albumin excretion QTL 15 2.9 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 29502665 70386295 Rat 61353 Bp35 Blood pressure QTL 35 0.001 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 8 30848154 61290444 Rat 631842 Inf1 Infertility severity QTL 1 4.1 0.001 seminal gland mass (VT:0010524) seminal vesicle wet weight (CMO:0001603) 8 22662330 67662330 Rat 737824 Hcar10 Hepatocarcinoma resistance QTL 10 2.9 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 8 40713066 82925667 Rat 1359033 Bp273 Blood pressure QTL 273 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 61290444 Rat 1331769 Rf39 Renal function QTL 39 3.871 urine output (VT:0003620) timed urine volume (CMO:0000260) 8 41866876 75097878 Rat 61358 Bp39 Blood pressure QTL 39 2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 35551938 80551938 Rat 1358906 Bp253 Blood pressure QTL 253 4 0.0004 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 40713066 93965294 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 1331744 Bp217 Blood pressure QTL 217 3.398 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 58482492 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 1582254 Kidm31 Kidney mass QTL 31 3 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 8 54237644 85365202 Rat 10402857 Bp380 Blood pressure QTL 380 0.95 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 631216 Stl9 Serum triglyceride level QTL 9 4.71 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 8 41867010 70386132 Rat 5684973 Bss100 Bone structure and strength QTL 100 4.7 tibia area (VT:1000281) tibia area measurement (CMO:0001382) 8 50095249 82460899 Rat 1582243 Bw66 Body weight QTL 66 3.4 0.0048 body mass (VT:0001259) body weight (CMO:0000012) 8 54237644 85365202 Rat 61373 Mcs4 Mammary carcinoma susceptibility QTL 4 1.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 8 16290444 61290444 Rat 2313057 Bss76 Bone structure and strength QTL 76 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 8 30848154 82460899 Rat 12879878 Bw183 Body weight QTL 183 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 43296169 98968765 Rat 1300177 Cm2 Cardiac mass QTL 2 3.65 heart mass (VT:0007028) heart weight (CMO:0000017) 8 54259986 100382532 Rat 1549908 Neudeg1 Neurodegradation QTL 1 5.5 0 nervous system integrity trait (VT:0010566) logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986) 8 30188867 94457446 Rat 12879879 Cm99 Cardiac mass QTL 99 0.001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 43296169 98968765 Rat 2313067 Bss77 Bone structure and strength QTL 77 3.1 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 8 30848154 82460899 Rat 12879880 Cm100 Cardiac mass QTL 100 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 43296169 98968765 Rat 12879881 Cm101 Cardiac mass QTL 101 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 8 43296169 98968765 Rat 12879882 Am8 Aortic mass QTL 8 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 43296169 98968765 Rat 12879883 Kidm65 Kidney mass QTL 65 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 43296169 98968765 Rat 1358912 Bw51 Body weight QTL 51 2.95 body mass (VT:0001259) body weight (CMO:0000012) 8 51351728 107062046 Rat 2313086 Bss60 Bone structure and strength QTL 60 4.1 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 8 50095249 82460899 Rat 1558646 Swd5 Spike wave discharge measurement QTL 5 3.45 0.00036 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge frequency (CMO:0001742) 8 14906751 59906751 Rat 2293697 Bmd39 Bone mineral density QTL 39 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 8 54043744 98968765 Rat 1331837 Bw23 Body weight QTL 23 4.19 0.00007 body mass (VT:0001259) body weight (CMO:0000012) 8 46531722 99083736 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 631271 Lecl1 Lens clarity QTL 1 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 8 18984168 84531599 Rat 2303564 Gluco43 Glucose level QTL 43 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 26130187 71130187 Rat 2303570 Gluco48 Glucose level QTL 48 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 49805831 94805831 Rat 2313046 Bss78 Bone structure and strength QTL 78 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 8 30848154 82460899 Rat 2303572 Insul13 Insulin level QTL 13 2 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 8 26130187 71130187 Rat 2301402 Bp316 Blood pressure QTL 316 0.005 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 631664 Hcar3 Hepatocarcinoma resistance QTL 3 2.9 0.0005 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 8 54237644 99103503 Rat
RH137998
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 57,380,657 - 57,380,834 (+) MAPPER mRatBN7.2 mRatBN7.2 6 30,044,462 - 30,044,637 (+) MAPPER mRatBN7.2 Rnor_6.0 6 32,357,725 - 32,357,899 NCBI Rnor6.0 Rnor_6.0 8 61,648,144 - 61,648,320 NCBI Rnor6.0 Rnor_5.0 8 60,217,623 - 60,217,799 UniSTS Rnor5.0 Rnor_5.0 6 42,143,993 - 42,144,167 UniSTS Rnor5.0 RGSC_v3.4 6 30,695,018 - 30,695,192 UniSTS RGSC3.4 RGSC_v3.4 8 60,726,440 - 60,726,616 UniSTS RGSC3.4 Celera 8 56,848,862 - 56,849,038 UniSTS Celera 6 29,501,854 - 29,502,028 UniSTS Cytogenetic Map 6 q14 UniSTS Cytogenetic Map 8 q24 UniSTS
UniSTS:236761
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 57,380,386 - 57,380,614 (+) MAPPER mRatBN7.2 Rnor_6.0 8 61,647,873 - 61,648,100 NCBI Rnor6.0 Rnor_5.0 8 60,217,352 - 60,217,579 UniSTS Rnor5.0 RGSC_v3.4 8 60,726,169 - 60,726,396 UniSTS RGSC3.4 Celera 8 56,848,591 - 56,848,818 UniSTS Cytogenetic Map 8 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000007261 ⟹ ENSRNOP00000007261
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 57,348,130 - 57,380,912 (+) Ensembl Rnor_6.0 Ensembl 8 61,615,650 - 61,648,390 (+) Ensembl
RefSeq Acc Id:
NM_001004270 ⟹ NP_001004270
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 66,244,127 - 66,276,876 (+) NCBI mRatBN7.2 8 57,348,158 - 57,380,912 (+) NCBI Rnor_6.0 8 61,615,650 - 61,648,398 (+) NCBI Rnor_5.0 8 60,184,262 - 60,224,290 (+) NCBI RGSC_v3.4 8 60,694,018 - 60,726,694 (+) RGD Celera 8 56,816,464 - 56,849,116 (+) RGD
Sequence:
GGCACCTTGGTGTGGGAAGATGGAAGAACTGAGCCAAGCCCTAGCTAGTAGCTTTTCTGTGTCTCAAGAACTGAACAGCACAGCTGCCCCACACCCTCGCCTGTCTCAATACAAGTCCAAGTATAGCT
hide sequence
RefSeq Acc Id:
XM_006243124 ⟹ XP_006243186
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 66,244,134 - 66,276,876 (+) NCBI mRatBN7.2 8 57,348,178 - 57,380,912 (+) NCBI Rnor_6.0 8 61,615,670 - 61,648,398 (+) NCBI Rnor_5.0 8 60,184,262 - 60,224,290 (+) NCBI
Sequence:
CTGGCCTTGTCTACTTTGGAGTTCTCTCTCAGCGCAAGCTGTAACTTCTTCCGACGGATTCTGGCTTCACCGCTGTTACCTGTGGAGGCCGGCCAGTCTTGCGGGTCTCGGATTTGGCCATCTTTCTG
hide sequence
RefSeq Acc Id:
XM_006243128 ⟹ XP_006243190
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 66,244,147 - 66,284,987 (+) NCBI mRatBN7.2 8 57,348,178 - 57,388,345 (+) NCBI Rnor_6.0 8 61,615,670 - 61,654,809 (+) NCBI Rnor_5.0 8 60,184,262 - 60,224,290 (+) NCBI
Sequence:
CTGGCCTTGTCTACTTTGGAGTTCTCTCTCAGCGCAAGCTGTAACTTCTTCCGACGGATTCTGG
hide sequence
RefSeq Acc Id:
XM_039081666 ⟹ XP_038937594
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 66,244,147 - 66,278,298 (+) NCBI mRatBN7.2 8 57,348,178 - 57,382,177 (+) NCBI
RefSeq Acc Id:
XM_039081668 ⟹ XP_038937596
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 66,244,147 - 66,271,347 (+) NCBI mRatBN7.2 8 57,348,178 - 57,374,516 (+) NCBI
RefSeq Acc Id:
XM_039081669 ⟹ XP_038937597
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 66,244,138 - 66,271,347 (+) NCBI mRatBN7.2 8 57,348,178 - 57,375,524 (+) NCBI
RefSeq Acc Id:
XM_039081670 ⟹ XP_038937598
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 66,243,684 - 66,271,347 (+) NCBI mRatBN7.2 8 57,348,061 - 57,375,524 (+) NCBI
RefSeq Acc Id:
XM_063265666 ⟹ XP_063121736
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 66,244,147 - 66,286,651 (+) NCBI
RefSeq Acc Id:
XM_063265667 ⟹ XP_063121737
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 66,243,662 - 66,286,651 (+) NCBI
RefSeq Acc Id:
XM_063265668 ⟹ XP_063121738
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 66,244,147 - 66,286,651 (+) NCBI
RefSeq Acc Id:
XM_063265670 ⟹ XP_063121740
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 66,244,147 - 66,286,651 (+) NCBI
RefSeq Acc Id:
XM_063265671 ⟹ XP_063121741
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 66,242,940 - 66,286,651 (+) NCBI
RefSeq Acc Id:
XM_063265672 ⟹ XP_063121742
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 66,243,683 - 66,271,347 (+) NCBI
RefSeq Acc Id:
XM_063265673 ⟹ XP_063121743
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 66,244,096 - 66,278,298 (+) NCBI
RefSeq Acc Id:
NP_001004270 ⟸ NM_001004270
- UniProtKB:
Q68FP5 (UniProtKB/Swiss-Prot), A6J4S2 (UniProtKB/TrEMBL)
- Sequence:
MEELSQALASSFSVSQELNSTAAPHPRLSQYKSKYSSLEQSERRRQLLELQKSKRLDYVNHARRLAEDDWTGMESGEEEKKKDEEEMDLDPVKKLPKRYANQLMLSEWLIDVPSDLGQEWIVVVCPVG
hide sequence
RefSeq Acc Id:
XP_006243190 ⟸ XM_006243128
- Peptide Label:
isoform X4
- Sequence:
MSSRPAWSTRRVPLQPGKMEELSQALASSFSVSQELNSTAAPHPRLSQYKSKYSSLEQSERRRQLLELQKSKRLDYVNHARRLAEDDWTGMESGEEEKKKDEEEMDLDPVKKLPKRYANQLMLSEWLI
hide sequence
RefSeq Acc Id:
XP_006243186 ⟸ XM_006243124
- Peptide Label:
isoform X3
- Sequence:
MSSRPAWSTRRVPLQPGKMEELSQALASSFSVSQELNSTAAPHPRLSQYKSKYSSLEQSERRRQLLELQKSKRLDYVNHARRLAEDDWTGMESGEEEKKKDEEEMDLDPVKKLPKRYANQLMLSEWLI
hide sequence
Ensembl Acc Id:
ENSRNOP00000007261 ⟸ ENSRNOT00000007261
RefSeq Acc Id:
XP_038937598 ⟸ XM_039081670
- Peptide Label:
isoform X9
RefSeq Acc Id:
XP_038937594 ⟸ XM_039081666
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_038937597 ⟸ XM_039081669
- Peptide Label:
isoform X7
RefSeq Acc Id:
XP_038937596 ⟸ XM_039081668
- Peptide Label:
isoform X6
RefSeq Acc Id:
XP_063121741 ⟸ XM_063265671
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063121737 ⟸ XM_063265667
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063121742 ⟸ XM_063265672
- Peptide Label:
isoform X8
RefSeq Acc Id:
XP_063121743 ⟸ XM_063265673
- Peptide Label:
isoform X10
- UniProtKB:
A6J4S1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063121736 ⟸ XM_063265666
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063121740 ⟸ XM_063265670
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063121738 ⟸ XM_063265668
- Peptide Label:
isoform X2
RGD ID: 13696004 Promoter ID: EPDNEW_R6529 Type: initiation region Name: Snupn_1 Description: snurportin 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 61,615,618 - 61,615,678 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-07
Snupn
snurportin 1
Rnut1
RNA, U transporter 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Rnut1
RNA, U transporter 1
Symbol and Name status set to approved
1299863 APPROVED
2005-07-14
Rnut1
RNA, U transporter 1
Symbol and Name status set to provisional
70820 PROVISIONAL
