Fam3c (FAM3 metabolism regulating signaling molecule C)

Gene: Fam3c (FAM3 metabolism regulating signaling molecule C) Rattus norvegicus

Analyze

Symbol:

Fam3c

Name:

FAM3 metabolism regulating signaling molecule C

RGD ID:

735193

Description:

Predicted to enable carbohydrate binding activity. Predicted to be located in Golgi apparatus. Predicted to be active in extracellular space. Orthologous to human FAM3C (FAM3 metabolism regulating signaling molecule C); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acetamide; ammonium chloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

FAM3C-like protein; family with sequence similarity 3, member C; interleukin-like EMT inducer; LOC312159

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	51,805,686 - 51,853,030 (-)	NCBI		GRCr8
mRatBN7.2	4	50,839,929 - 50,887,276 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	50,838,818 - 50,888,078 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	55,825,466 - 55,872,830 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	51,746,545 - 51,793,901 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	50,172,124 - 50,219,707 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	49,388,962 - 49,439,892 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	49,387,989 - 49,439,867 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	49,179,381 - 49,231,971 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	48,628,905 - 48,676,252 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	48,859,478 - 48,906,826 (-)	NCBI
Celera	4	46,046,371 - 46,093,722 (-)	NCBI		Celera
Cytogenetic Map	4	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

pleomorphic xanthoastrocytoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

17alpha-ethynylestradiol (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

9-cis-retinoic acid (ISO)

acetamide (EXP)

acrylamide (ISO)

all-trans-4-oxoretinoic acid (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

avobenzone (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (EXP)

chlorpyrifos (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

dibutyl phthalate (ISO)

diuron (ISO)

dorsomorphin (ISO)

epoxiconazole (ISO)

fenthion (ISO)

fipronil (EXP)

flutamide (EXP)

glafenine (EXP)

glyphosate (EXP)

irinotecan (ISO)

isotretinoin (ISO)

ivermectin (ISO)

lead(0) (ISO)

methidathion (ISO)

methylmercury chloride (ISO)

methylparaben (ISO)

N-nitrosodiethylamine (EXP,ISO)

nickel sulfate (ISO)

paclitaxel (ISO)

paracetamol (ISO)

potassium chromate (ISO)

quercitrin (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

thapsigargin (EXP)

thimerosal (ISO)

thioacetamide (EXP)

trichostatin A (ISO)

tunicamycin (ISO)

uranium atom (ISO)

urethane (ISO)

valproic acid (ISO)

vincaleukoblastine (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

cytoplasmic vesicle (IEA)

extracellular space (IBA,IEA)

Golgi apparatus (IEA,ISO)

membrane (IEA)

Molecular Function

carbohydrate binding (IEA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Cloning, expression, and initial characterization of a novel cytokine-like gene family.	Zhu Y, etal., Genomics 2002 Aug;80(2):144-50.

Additional References at PubMed

PMID:23376485	PMID:23533145	PMID:24006456

Genomics

Comparative Map Data

Fam3c
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	51,805,686 - 51,853,030 (-)	NCBI		GRCr8
mRatBN7.2	4	50,839,929 - 50,887,276 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	50,838,818 - 50,888,078 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	55,825,466 - 55,872,830 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	51,746,545 - 51,793,901 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	50,172,124 - 50,219,707 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	49,388,962 - 49,439,892 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	49,387,989 - 49,439,867 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	49,179,381 - 49,231,971 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	48,628,905 - 48,676,252 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	48,859,478 - 48,906,826 (-)	NCBI
Celera	4	46,046,371 - 46,093,722 (-)	NCBI		Celera
Cytogenetic Map	4	q22	NCBI

FAM3C
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	121,348,878 - 121,396,396 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	121,348,878 - 121,396,364 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	120,988,932 - 121,036,362 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	120,776,141 - 120,823,658 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	120,582,857 - 120,630,292	NCBI
Celera	7	115,798,102 - 115,845,614 (-)	NCBI		Celera
Cytogenetic Map	7	q31.31	NCBI
HuRef	7	115,352,144 - 115,399,666 (-)	NCBI		HuRef
CHM1_1	7	120,922,224 - 120,969,734 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	122,664,194 - 122,711,727 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	120,383,656 - 120,431,153 (-)	NCBI

Fam3c
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	22,306,519 - 22,356,080 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	22,306,519 - 22,356,242 (-)	Ensembl		GRCm39 Ensembl
GRCm38	6	22,306,520 - 22,356,081 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	22,306,520 - 22,356,243 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	22,256,522 - 22,306,081 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	22,256,523 - 22,306,082 (-)	NCBI		MGSCv36	mm8
Celera	6	22,360,644 - 22,410,200 (-)	NCBI		Celera
Cytogenetic Map	6	A3.1	NCBI
cM Map	6	9.24	NCBI

Fam3c
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955479	3,083,719 - 3,128,610 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955479	3,086,380 - 3,128,612 (-)	NCBI	ChiLan1.0	ChiLan1.0

FAM3C
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	158,222,632 - 158,270,292 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	10,234,045 - 10,280,463 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	113,361,718 - 113,409,292 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	126,048,752 - 126,096,440 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	126,048,752 - 126,096,440 (-)	Ensembl	panpan1.1		panPan2

FAM3C
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	14	59,407,920 - 59,447,257 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	14	59,410,012 - 59,447,258 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	14	58,822,333 - 58,874,998 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	59,441,840 - 59,494,504 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	14	59,441,846 - 59,494,523 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	14	59,535,226 - 59,587,846 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	14	59,160,036 - 59,212,872 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	14	59,538,294 - 59,591,126 (-)	NCBI		UU_Cfam_GSD_1.0

Fam3c
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	48,355,297 - 48,396,837 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936605	3,807,032 - 3,848,634 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936605	3,807,089 - 3,848,633 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FAM3C
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	18	25,569,536 - 25,612,458 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	18	25,569,356 - 25,612,072 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	18	27,174,036 - 27,216,644 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FAM3C
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	90,166,576 - 90,214,387 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	90,166,520 - 90,214,384 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666042	13,347,749 - 13,395,379 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fam3c
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624783	14,690,948 - 14,739,458 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624783	14,690,954 - 14,741,027 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Fam3c
393 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	286
Count of miRNA genes:	183
Interacting mature miRNAs:	213
Transcripts:	ENSRNOT00000007886
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
619616	Bp79	Blood pressure QTL 79		0.0292	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	5214602	78882945	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
2302371	Stl22	Serum triglyceride level QTL 22	5.15		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5218294	57114705	Rat
1358203	Stl19	Serum triglyceride level QTL 19	2.8	0.002	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5218294	65958103	Rat
631642	Stl2	Serum triglyceride level QTL 2	3.3		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5219178	56647776	Rat
6478724	Anxrr35	Anxiety related response QTL 35		0.00449	defecation behavior trait (VT:0010462)	defecation measurement (CMO:0000997)	4	10084089	55084089	Rat
6478766	Anxrr47	Anxiety related response QTL 47		0.09637	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	10084089	55084089	Rat
6478769	Anxrr48	Anxiety related response QTL 48		0.02514	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	10084089	55084089	Rat
8694374	Bw155	Body weight QTL 155	3.39	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	4	10084089	55084089	Rat
9590304	Scort17	Serum corticosterone level QTL 17	4.96	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	10084089	55084089	Rat
8552906	Pigfal3	Plasma insulin-like growth factor 1 level QTL 3			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	4	10084089	55084089	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	10814170	91360527	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
2303585	Bw86	Body weight QTL 86	4		body mass (VT:0001259)	body weight (CMO:0000012)	4	14678065	59678065	Rat
2313401	Anxrr27	Anxiety related response QTL 27			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	4	17933508	62933508	Rat
61412	Pia2	Pristane induced arthritis QTL 2	3.9		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	4	21333343	62278020	Rat
6909122	Insul22	Insulin level QTL 22	4.63		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	4	26907285	75585128	Rat
6909128	Pancm4	Pancreatic morphology QTL 4	11.35		pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	4	26907285	75585128	Rat
8655906	Rf60	Renal function QTL 60	3.8		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	4	29494195	81006281	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	32583980	114627242	Rat
11530004	Niddm71	Non-insulin dependent diabetes mellitus QTL 71		0.001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	4	32584199	52754138	Rat
8552782	Vie1	Viral induced encephalitis QTL 1	26.4		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	34430484	82490359	Rat
8552801	Bw143	Body weight QTL 143	7.3		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	4	34430484	82490359	Rat
8552809	Vie5	Viral induced encephalitis QTL 5	25.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	34430484	82490359	Rat
8655961	Kidm43	Kidney mass QTL 43	18		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	36303261	103194984	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	38465774	146803430	Rat
61475	Aia2	Adjuvant induced arthritis QTL 2	5.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	39505275	73892441	Rat
1331807	Rf31	Renal function QTL 31	2.988		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	4	39524264	74726312	Rat
1300139	Hrtrt6	Heart rate QTL 6	2.85		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	39524264	116179656	Rat
61445	Strs3	Sensitivity to stroke QTL 3	3		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	4	40433388	85433388	Rat
8694439	Bw168	Body weight QTL 168	9.57	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	40433414	85433414	Rat
6893678	Bw108	Body weight QTL 108	2.6	0.006	body mass (VT:0001259)	body weight (CMO:0000012)	4	43457976	88457976	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	44463908	148090542	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	44463908	148090542	Rat
2312567	Glom19	Glomerulus QTL 19	1.9	0.006	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	4	45456990	146803430	Rat
10450818	Scl76	Serum cholesterol level QTL 76	3.6	0.01	blood VLDL cholesterol amount (VT:0005144)	blood high density lipoprotein cholesterol level (CMO:0000052)	4	49178116	57114705	Rat
10450821	Scl77	Serum cholesterol level QTL 77	4.1	0.01	blood VLDL cholesterol amount (VT:0005144)	blood high density lipoprotein cholesterol level (CMO:0000052)	4	49178116	57114705	Rat
10450825	Scl78	Serum cholesterol level QTL 78	3.7	0.01	blood VLDL cholesterol amount (VT:0005144)	blood low density lipoprotein cholesterol level (CMO:0000053)	4	49178116	57114705	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	50119848	146803430	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	33	42	26	19	26	3	3	74	35	34	11	3
Low		10	15	15		15	5	8			7		5
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_198771	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY228475	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473959	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000077889 ⟹ ENSRNOP00000069031

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	50,839,921 - 50,887,296 (-)	Ensembl
Rnor_6.0 Ensembl	4	49,389,501 - 49,422,824 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000090583 ⟹ ENSRNOP00000075071

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	50,838,818 - 50,888,078 (-)	Ensembl
Rnor_6.0 Ensembl	4	49,387,989 - 49,439,867 (-)	Ensembl

RefSeq Acc Id:

NM_198771 ⟹ NP_942066

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	51,805,686 - 51,853,030 (-)	NCBI
mRatBN7.2	4	50,839,929 - 50,887,276 (-)	NCBI
Rnor_6.0	4	49,388,962 - 49,439,892 (-)	NCBI
Rnor_5.0	4	49,179,381 - 49,231,971 (-)	NCBI
RGSC_v3.4	4	48,628,905 - 48,676,252 (-)	RGD
Celera	4	46,046,371 - 46,093,722 (-)	RGD

Sequence:

show sequence

AGGCGCGATCGGCGCGCTCGGGAGGCGGCGGCGGCGGCACCTCCCGTCGGCCTCCGTCAGAACT
GACGGCGGCGCGACCGCAGGCAGGTCATTCTTTCCTAGAAGTGCTAGAGAGTAAGAAGGCAAAA
ATGAGGGTAGCAGGAGCCGCAAAGTTGGTGGTAGCCGTGGCAGTGTTCTTACTGACCTTCTATG
TTATTTCTCAAGTTTTCGAAATTAAAATGGATGCAAGTTTAGGAAGTCTATTTGCCCGATCTGC
GTTGGACTCAGCCATTCGCTCAACGAAGCCTCCCAGGTACAAATGTGGGATCTCAAAAGCGTGC
CCGGAGAAGCATTTTGCTTTTAAAATGGCGAGCGGAGCAGCCAATGTAGTAGGACCCAAGATCT
GCCTGGAAGATAATGTTTTGATGAGCGGTGTGAAGAACAATGTTGGGAGAGGGATAAATGTTGC
CCTGGTGAACGGGAAAACGGGAGATGTGATAGATACCAAATATTTTGACATGTGGGGAGGAGAT
GTGGCACCATTCATTGAGTTTTTGAAGACCATACAGGACGGGACAGTAGTGTTAATGGCAACGT
ACGATGATGGAGCAACCAAACTCACGGAAGAGGCACGGCGACTCATCGCCGAACTGGGGAGCAC
ATCCATCACCAGTCTTGGCTTCCGAGATAACTGGGTCTTCTGTGGTGGCAAGGGCATTAAGACA
AAGAGCCCCTTCGAACAGCACATAAAGAACAATAAAGACACAAACAAGTACGAGGGGTGGCCCG
AGGTGGTCGAGATGGAAGGATGCATCCCCCAGAAGCAAGACTGACGGGCACCGGAGGCGAGGAC
AAACGCACTTCGATTCTGTGGGAGAGCTGTCAAGCAGCCGCGCGGTGTACATATTTCAGTAGCA
TGAGGCCGTCCAGGGTGTGCATGAGCAAGACCATGATGCCAGGATTATTTATTGCTAACAGAAA
TGGCTACCTTTGTAAATAGACCTCATTGAGCCAATCACTGAACTCTTTGTAAGCACATTTCCCC
CAAAGTCCAGTGTTTAGACGACAGTGGCAATAATGTATTCATTCTAGTAGTCAGTGGTAACCAG
GCAGCTTGTATAGGACATTGATATTTACCCTGGTTGCTGTGAAACCCTATCCATGGAATAACAT
GGCTTTTAGAAAAGGAGGAGATTTTGTTATATGTGTCTCTGTATAAGTATCTGGCATGTGCTGA
GAGTATCCTTTAAATTAAAGAGATTTTTGGCTAGTTGTATATGTACTGTTACCCTACAGTCTGA
CTCATGTTGTATCTGTTCACAGTCTTTATTTTTTTTCCCTTCCAAAGAAATCCAGAAATAAAAA
CTTTTCCCAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_942066	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAO73558	(Get FASTA)	NCBI Sequence Viewer
	EDM15150	(Get FASTA)	NCBI Sequence Viewer
	EDM15151	(Get FASTA)	NCBI Sequence Viewer
	EDM15152	(Get FASTA)	NCBI Sequence Viewer
	EDM15153	(Get FASTA)	NCBI Sequence Viewer
	EDM15154	(Get FASTA)	NCBI Sequence Viewer
	EDM15155	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000069031
	ENSRNOP00000069031.2
	ENSRNOP00000075071.2
GenBank Protein	Q810F4	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_942066 ⟸ NM_198771
- Peptide Label:	precursor
- UniProtKB:	Q810F4 (UniProtKB/Swiss-Prot), A6IE65 (UniProtKB/TrEMBL), A0A0G2JUB0 (UniProtKB/TrEMBL), A6IE64 (UniProtKB/TrEMBL)
- Sequence:	show sequence MRVAGAAKLVVAVAVFLLTFYVISQVFEIKMDASLGSLFARSALDSAIRSTKPPRYKCGISKAC PEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALVNGKTGDVIDTKYFDMWGGD VAPFIEFLKTIQDGTVVLMATYDDGATKLTEEARRLIAELGSTSITSLGFRDNWVFCGGKGIKT KSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD hide sequence

RefSeq Acc Id:

ENSRNOP00000075071 ⟸ ENSRNOT00000090583

RefSeq Acc Id:

ENSRNOP00000069031 ⟸ ENSRNOT00000077889

Protein Domains

GG-type lectin ILEI/PANDER

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q810F4-F1-model_v2	AlphaFold	Q810F4	1-227	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692900

Promoter ID:

EPDNEW_R3425

Type:

initiation region

Name:

Fam3c_1

Description:

family with sequence similarity 3, member C

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	49,439,950 - 49,440,010	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:735193	AgrOrtholog
BioCyc Gene	G2FUF-45505	BioCyc
Ensembl Genes	ENSRNOG00000060349	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000077889	ENTREZGENE
	ENSRNOT00000077889.2	UniProtKB/TrEMBL
	ENSRNOT00000090583.2	UniProtKB/TrEMBL
InterPro	FAM3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ILEI/PANDER_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ILEI_FAM3C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:312159	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	312159	ENTREZGENE
PANTHER	PTHR14592	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR14592:SF10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	ILEI	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Fam3c	PhenoGen
PROSITE	GG_LECTIN	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000060349	RatGTEx
UniProt	A0A0G2JUB0	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2RAP9_RAT	UniProtKB/TrEMBL
	A6IE63_RAT	UniProtKB/TrEMBL
	A6IE64	ENTREZGENE, UniProtKB/TrEMBL
	A6IE65	ENTREZGENE, UniProtKB/TrEMBL
	A6IE66_RAT	UniProtKB/TrEMBL
	A6IE67_RAT	UniProtKB/TrEMBL
	A6IE68_RAT	UniProtKB/TrEMBL
	FAM3C_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-10-04	Fam3c	FAM3 metabolism regulating signaling molecule C	Fam3c	family with sequence similarity 3, member C	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-07-08	Fam3c	family with sequence similarity 3, member C	LOC312159	FAM3C-like protein	Symbol and Name updated	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar