Csnk1a1 (casein kinase 1, alpha 1)

Gene: Csnk1a1 (casein kinase 1, alpha 1) Rattus norvegicus

Analyze

Symbol:

Csnk1a1

Name:

casein kinase 1, alpha 1

RGD ID:

71098

Description:

Enables several functions, including ion binding activity; phosphoprotein binding activity; and protein serine/threonine kinase activity. Predicted to be involved in several processes, including intermediate filament cytoskeleton organization; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; and regulation of signal transduction. Predicted to act upstream of or within cell morphogenesis. Located in nuclear speck. Orthologous to human CSNK1A1 (casein kinase 1 alpha 1); PARTICIPATES IN dopamine signaling pathway; Hedgehog signaling pathway; p53 signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

casein kinase I; casein kinase I isoform alpha; CK1; CKI-alpha; MGC156603

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CSNK1A1 (casein kinase 1 alpha 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Csnk1a1 (casein kinase 1, alpha 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Csnk1a1 (casein kinase 1 alpha 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CSNK1A1 (casein kinase 1 alpha 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CSNK1A1 (casein kinase 1 alpha 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Csnk1a1 (casein kinase 1 alpha 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CSNK1A1 (casein kinase 1 alpha 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CSNK1A1 (casein kinase 1 alpha 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Csnk1a1 (casein kinase 1 alpha 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CSNK1A1L (casein kinase 1 alpha 1 like)	HGNC	OrthoDB, Panther, Treefam
Alliance orthologs ³
Homo sapiens (human):	CSNK1A1 (casein kinase 1 alpha 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	Csnk1a1 (casein kinase 1, alpha 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	csnk1a1 (casein kinase 1, alpha 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	HRR25	Alliance	DIOPT (InParanoid\|OrthoInspector\|SonicParanoid)
Caenorhabditis elegans (roundworm):	kin-19	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CkIalpha	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	csnk1a1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	57,285,156 - 57,320,540 (+)	NCBI		GRCr8
mRatBN7.2	18	55,017,049 - 55,050,184 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	55,017,055 - 55,049,271 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	57,110,855 - 57,142,124 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	57,825,472 - 57,856,741 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	55,640,937 - 55,672,070 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	56,887,722 - 56,910,610 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	56,887,354 - 56,918,345 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	56,116,635 - 56,139,523 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	57,541,673 - 57,564,560 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	57,613,904 - 57,636,793 (+)	NCBI
Celera	18	53,168,136 - 53,191,023 (+)	NCBI		Celera
Cytogenetic Map	18	q12.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adult T-cell leukemia/lymphoma (ISO)

Alzheimer's disease (ISO)

Craniofacial Abnormalities (ISO)

familial adenomatous polyposis 1 (ISO)

Hereditary Neoplastic Syndromes (ISO)

inclusion body myositis (ISO)

Neurodevelopmental Disorders (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-ethoxyethanol (EXP)

2-methoxyethanol (EXP)

4,4'-diaminodiphenylmethane (ISO)

4-hydroxyphenyl retinamide (ISO)

ammonium chloride (EXP)

Aroclor 1254 (ISO)

atrazine (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (ISO)

calcium atom (EXP)

calcium(0) (EXP)

carbonyl sulfide (EXP)

casticin (ISO)

CGP 52608 (ISO)

chlormequat chloride (EXP)

chloroprene (EXP)

chlorpyrifos (ISO)

choline (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

deguelin (ISO)

dibutyl phthalate (ISO)

diuron (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

ethanol (ISO)

flavonoids (EXP)

flutamide (EXP)

folic acid (ISO)

FR900359 (ISO)

gentamycin (EXP)

inulin (ISO)

ivermectin (ISO)

L-methionine (ISO)

leflunomide (ISO)

lenalidomide (ISO)

levonorgestrel (ISO)

methylmercury chloride (ISO)

miconazole (ISO)

mono(2-ethylhexyl) phthalate (ISO)

N-(2-aminoethyl)-5-chloroisoquinoline-8-sulfonamide (ISO)

N-methyl-4-phenylpyridinium (ISO)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

piroxicam (ISO)

pyrvinium (ISO)

quinacrine (ISO)

resveratrol (ISO)

rotenone (EXP)

SB 431542 (ISO)

selenium atom (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

Soman (EXP)

sunitinib (ISO)

testosterone undecanoate (ISO)

thioacetamide (EXP)

toluene (EXP)

urethane (ISO)

valproic acid (ISO)

vanadium atom (ISO)

vanadium(0) (ISO)

vinclozolin (EXP)

vincristine (ISO)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell division (IEA)

cell morphogenesis (ISO)

cellular response to nutrient (IEA,ISO)

Golgi organization (IEA,ISO)

intermediate filament cytoskeleton organization (IEA,ISO,ISS)

negative regulation of canonical Wnt signaling pathway (IBA,IC,IEA,ISO)

negative regulation of NLRP3 inflammasome complex assembly (ISO,ISS)

positive regulation of proteasomal ubiquitin-dependent protein catabolic process (IEA,ISO)

positive regulation of Rho protein signal transduction (IEA,ISO)

positive regulation of TORC1 signaling (IEA,ISO)

protein phosphorylation (IDA)

signal transduction (IBA)

Wnt signaling pathway (IEA)

Cellular Component

beta-catenin destruction complex (IEA,ISO,ISS)

centrosome (IEA,ISO)

ciliary basal body (ISO,ISS)

cytoplasm (IEA)

cytosol (IEA,ISO,TAS)

intracellular organelle (IEA)

keratin filament (IEA,ISO,ISS)

kinetochore (IEA)

mRNA cleavage and polyadenylation specificity factor complex (IEA,ISO,ISS)

nuclear speck (IDA,IEA,ISO,ISS)

nucleus (IBA,IEA)

ribonucleoprotein complex (ISO)

spindle (ISO,ISS)

Molecular Function

ATP binding (IDA,IEA)

magnesium ion binding (IDA)

peptide binding (IDA)

phosphoprotein binding (IDA)

protein binding (IPI,ISO)

protein kinase activity (ISO,ISS)

protein serine kinase activity (IEA)

protein serine/threonine kinase activity (IBA,IDA,IEA,ISO,TAS)

Molecular Pathway Annotations Click to see Annotation Detail View

dopamine signaling pathway (ISO)

Hedgehog signaling pathway (IEA,ISO)

p53 signaling pathway (ISO)

Wnt signaling pathway (IEA)

Wnt signaling, canonical pathway (ISO)

Wnt signaling, non-canonical pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Opioid receptor agonists enhance the phosphorylation state of Fas-associated death domain (FADD) protein in the rat brain: functional interactions with casein kinase Ialpha, Galpha(i) proteins, and ERK1/2 signaling.	Garcia-Fuster MJ, etal., Neuropharmacology. 2008 Oct;55(5):886-99. doi: 10.1016/j.neuropharm.2008.06.071. Epub 2008 Jul 9.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	A new molecular link between the fibrillar and granulovacuolar lesions of Alzheimer's disease.	Ghoshal N, etal., Am J Pathol. 1999 Oct;155(4):1163-72.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	CKIalpha is associated with and phosphorylates star-PAP and is also required for expression of select star-PAP target messenger RNAs.	Gonzales ML, etal., J Biol Chem. 2008 May 2;283(18):12665-73. doi: 10.1074/jbc.M800656200. Epub 2008 Feb 27.
6.	The casein kinase Ialpha isoform is both physically positioned and functionally competent to regulate multiple events of mRNA metabolism.	Gross SD, etal., J Cell Sci. 1999 Aug;112 ( Pt 16):2647-56.
7.	Casein kinase 1 alpha associates with the tau-bearing lesions of inclusion body myositis.	Kannanayakal TJ, etal., Neurosci Lett. 2008 Jan 31;431(2):141-5. doi: 10.1016/j.neulet.2007.11.066. Epub 2007 Dec 15.
8.	Wnt signalling and its impact on development and cancer.	Klaus A and Birchmeier W, Nat Rev Cancer. 2008 May;8(5):387-98.
9.	Control of beta-catenin phosphorylation/degradation by a dual-kinase mechanism.	Liu C, etal., Cell. 2002 Mar 22;108(6):837-47.
10.	Gene Data Set	MGD Curation, June 12, 2002
11.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
13.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
14.	GOA pipeline	RGD automated data pipeline
15.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
16.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
17.	Comprehensive gene review and curation	RGD comprehensive gene curation
18.	DARPP-32, Jack of All Trades... Master of Which?	Yger M and Girault JA, Front Behav Neurosci. 2011 Sep 8;5:56. doi: 10.3389/fnbeh.2011.00056. eCollection 2011.
19.	Casein kinase I alpha and alpha L: alternative splicing-generated kinases exhibit different catalytic properties.	Zhang J, etal., Biochemistry 1996 Dec 17;35(50):16319-27.

Additional References at PubMed

PMID:12477932	PMID:14681019	PMID:15896722	PMID:17686994	PMID:19364825	PMID:19946888	PMID:20067794	PMID:21331045	PMID:21399614	PMID:21709260	PMID:21930935	PMID:22871113
PMID:23902688	PMID:24760862	PMID:25500533	PMID:25644602

Genomics

Comparative Map Data

Csnk1a1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	57,285,156 - 57,320,540 (+)	NCBI		GRCr8
mRatBN7.2	18	55,017,049 - 55,050,184 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	55,017,055 - 55,049,271 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	57,110,855 - 57,142,124 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	57,825,472 - 57,856,741 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	55,640,937 - 55,672,070 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	56,887,722 - 56,910,610 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	56,887,354 - 56,918,345 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	56,116,635 - 56,139,523 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	57,541,673 - 57,564,560 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	57,613,904 - 57,636,793 (+)	NCBI
Celera	18	53,168,136 - 53,191,023 (+)	NCBI		Celera
Cytogenetic Map	18	q12.1	NCBI

CSNK1A1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	149,492,982 - 149,551,439 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	149,492,982 - 149,551,471 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	148,872,545 - 148,931,002 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	148,855,038 - 148,911,200 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	148,855,741 - 148,910,850	NCBI
Celera	5	144,956,788 - 145,012,931 (-)	NCBI		Celera
Cytogenetic Map	5	q32	NCBI
HuRef	5	144,021,796 - 144,077,664 (-)	NCBI		HuRef
CHM1_1	5	148,307,871 - 148,363,537 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	150,027,795 - 150,086,185 (-)	NCBI		T2T-CHM13v2.0

Csnk1a1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	61,687,307 - 61,723,391 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	61,688,345 - 61,723,132 (+)	Ensembl		GRCm39 Ensembl
GRCm38	18	61,554,236 - 61,590,320 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	61,555,274 - 61,590,061 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	18	61,715,236 - 61,747,953 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	18	61,680,951 - 61,713,668 (+)	NCBI		MGSCv36	mm8
Celera	18	62,838,154 - 62,870,841 (+)	NCBI		Celera
Cytogenetic Map	18	E1	NCBI
cM Map	18	34.62	NCBI

Csnk1a1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	4,921,852 - 4,966,705 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955415	4,921,356 - 4,966,705 (+)	NCBI	ChiLan1.0	ChiLan1.0

CSNK1A1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	144,724,209 - 144,781,337 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	142,863,758 - 142,920,361 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	144,919,775 - 144,977,105 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	150,929,397 - 150,985,930 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	150,929,420 - 150,985,912 (-)	Ensembl	panpan1.1		panPan2

CSNK1A1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	59,435,530 - 59,485,591 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	59,435,764 - 59,483,475 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	59,200,573 - 59,251,121 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	59,917,581 - 59,968,297 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	59,917,668 - 59,968,538 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	59,704,847 - 59,755,283 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	59,818,995 - 59,869,549 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	60,349,721 - 60,400,321 (+)	NCBI		UU_Cfam_GSD_1.0

Csnk1a1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	143,777,433 - 143,820,877 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936504	5,351,029 - 5,396,034 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936504	5,351,354 - 5,394,856 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CSNK1A1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	150,612,077 - 150,662,284 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	150,612,845 - 150,662,431 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	157,378,846 - 157,428,423 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CSNK1A1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	52,111,500 - 52,169,043 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	52,114,053 - 52,168,998 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666034	25,552,342 - 25,611,260 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Csnk1a1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624774	8,815,023 - 8,862,878 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624774	8,815,021 - 8,862,657 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Csnk1a1
133 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	637
Count of miRNA genes:	258
Interacting mature miRNAs:	329
Transcripts:	ENSRNOT00000044346, ENSRNOT00000066133
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2299160	Iddm35	Insulin dependent diabetes mellitus QTL 35	2.79		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	18	4207941	60377792	Rat
2293708	Bss46	Bone structure and strength QTL 46	8.8	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	18	11791518	63636873	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	11791518	83218561	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	11791518	83218561	Rat
1358358	Sradr6	Stress Responsive Adrenal Weight QTL 6	2.49		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	18	11944299	59330563	Rat
6903359	Bp355	Blood pressure QTL 355	3.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11944544	59796478	Rat
2313082	Bss85	Bone structure and strength QTL 85	0.8	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	18	14951337	59951337	Rat
1358193	Emca2	Estrogen-induced mammary cancer QTL 2	1.6		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	18	18007599	63571040	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19278901	83218561	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	21372893	83213037	Rat
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	24796977	79788953	Rat
2325839	Bp348	Blood pressure QTL 348		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	25570985	70570985	Rat
2293704	Bss35	Bone structure and strength QTL 35	4.59	0.0002	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	18	28964853	73964853	Rat
2300157	Bmd66	Bone mineral density QTL 66	13.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	18	28964853	73964853	Rat
2300177	Bmd65	Bone mineral density QTL 65	19.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	18	28964853	73964853	Rat
9589816	Gluco68	Glucose level QTL 68	7.25	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	29792965	74792965	Rat
8694378	Bw157	Body weight QTL 157	3.59	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	29792965	74792965	Rat
9590318	Scort22	Serum corticosterone level QTL 22	7.64	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	18	29792965	74792965	Rat
1331754	Bp230	Blood pressure QTL 230	4.61609		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	29792965	74792965	Rat
738005	Anxrr11	Anxiety related response QTL 11	3.4		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	18	30039813	75039813	Rat
61383	Bp47	Blood pressure QTL 47	17.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	31271681	60377755	Rat
1331742	Bp228	Blood pressure QTL 228	3.88752		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	59796643	Rat
1331774	Bp226	Blood pressure QTL 226	4.41065		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	59796643	Rat
1331776	Bp225	Blood pressure QTL 225	2.829		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	31359408	59796643	Rat
1331798	Bp224	Blood pressure QTL 224	3.53873		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	59796643	Rat
1331727	Bp237	Blood pressure QTL 237	3.053		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	61698465	Rat
61429	Cia17	Collagen induced arthritis QTL 17	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	18	31359408	70263868	Rat
2303120	Mamtr8	Mammary tumor resistance QTL 8		0.001	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	18	31359408	83218561	Rat
6903347	Bp350	Blood pressure QTL 350	4.4		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359530	59796478	Rat
631274	Sprol1	Serum protein level QTL 1	5.3		blood total protein amount (VT:0005567)	serum total protein level (CMO:0000661)	18	31393320	77209694	Rat
631518	Bw11	Body weight QTL 11	2.8		body mass (VT:0001259)	body weight (CMO:0000012)	18	35870723	80870723	Rat
61367	Iddm4	Insulin dependent diabetes mellitus QTL 4	2.33	0.0074	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	38192455	83192455	Rat
1598826	Anxrr20	Anxiety related response QTL 20	3.04		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	18	41432971	83828827	Rat
6893683	Bw110	Body weight QTL 110	2.7	0.002	body mass (VT:0001259)	body weight (CMO:0000012)	18	43345022	83828827	Rat
8694366	Abfw8	Abdominal fat weight QTL 8	6.38	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	18	46640675	83828827	Rat
8694432	Bw165	Body weight QTL 165	3.81	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	46640675	83828827	Rat
9589041	Epfw12	Epididymal fat weight QTL 12	17.08	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	18	46640675	83828827	Rat
1331806	Bp229	Blood pressure QTL 229	4.36484		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	46718763	57867167	Rat
1331736	Bp227	Blood pressure QTL 227	2.791		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	46718763	59796643	Rat
1331780	Bp238	Blood pressure QTL 238	3.269		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	46718763	59796643	Rat
6903345	Bp349	Blood pressure QTL 349	3.9		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	46718935	59796478	Rat
6903349	Bp351	Blood pressure QTL 351	3.5		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	46718935	59796478	Rat
6903351	Bp352	Blood pressure QTL 352	3.3		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	46718935	59796478	Rat
61360	Eaey	Experimental allergic encephalomyelitis QTL y	3		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis duration (CMO:0001424)	18	46988939	60377753	Rat
2303571	Bw92	Body weight QTL 92	3		body mass (VT:0001259)	body weight (CMO:0000012)	18	48520044	83828827	Rat
2303584	Gluco55	Glucose level QTL 55	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	18	48520044	83828827	Rat
7411719	Strs5	Sensitivity to stroke QTL 5	9.4		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	18	49999958	65845095	Rat
2293658	Bmd23	Bone mineral density QTL 23	7.3	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	18	51464733	63636873	Rat
738008	Hcar14	Hepatocarcinoma resistance QTL 14	4.3		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion number (CMO:0001462)	18	51464733	83218561	Rat
1331730	Scl27	Serum cholesterol level QTL 27	3.826		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	18	52292875	59796643	Rat
1331752	Bw27	Body weight QTL 27	2.963		body mass (VT:0001259)	body weight (CMO:0000012)	18	52292875	65845095	Rat
1359020	Ppulsi2	Prepulse inhibition QTL 2	2.71		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	18	52292875	73997283	Rat
1600375	Mcs22	Mammary carcinoma susceptibility QTL 22	3.3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	18	52539763	63933058	Rat
631509	Sald2	Serum aldosterone level QTL 2	2.9		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	18	52539763	69140759	Rat
12880368	Bw187	Body weight QTL 187		0.045	body mass (VT:0001259)	body weight (CMO:0000012)	18	52539763	76104388	Rat
12904067	Cm122	Cardiac mass QTL 122		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	52539763	76104388	Rat
12904069	Cm123	Cardiac mass QTL 123		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	52539763	76104388	Rat
12904070	Cm124	Cardiac mass QTL 124		0.01	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	52539763	76104388	Rat
12904071	Am18	Aortic mass QTL 18		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	52539763	76104388	Rat
12904073	Kidm71	Kidney mass QTL 71		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	52539763	76104388	Rat
2301417	Bp319	Blood pressure QTL 319		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	52539763	76104388	Rat
1300125	Rf26	Renal function QTL 26	3.2		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	18	52539863	65844950	Rat
1298072	Cia26	Collagen induced arthritis QTL 26	3.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	18	54709769	83828827	Rat

Markers in Region

X90945

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	55,047,422 - 55,047,578 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	56,917,597 - 56,917,752	NCBI	Rnor6.0
Rnor_5.0	18	56,146,510 - 56,146,665	UniSTS	Rnor5.0
RGSC_v3.4	18	57,571,548 - 57,571,703	UniSTS	RGSC3.4
Celera	18	53,198,010 - 53,198,165	UniSTS
Cytogenetic Map	18	q12.1	UniSTS

RH144160

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	55,042,536 - 55,042,744 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	56,912,711 - 56,912,918	NCBI	Rnor6.0
Rnor_5.0	18	56,141,624 - 56,141,831	UniSTS	Rnor5.0
RGSC_v3.4	18	57,566,662 - 57,566,869	UniSTS	RGSC3.4
Celera	18	53,193,124 - 53,193,331	UniSTS
RH 3.4 Map	18	540.3	UniSTS
Cytogenetic Map	18	q12.1	UniSTS

BE111197

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	55,045,347 - 55,045,525 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	56,915,522 - 56,915,699	NCBI	Rnor6.0
Rnor_5.0	18	56,144,435 - 56,144,612	UniSTS	Rnor5.0
RGSC_v3.4	18	57,569,473 - 57,569,650	UniSTS	RGSC3.4
Celera	18	53,195,935 - 53,196,112	UniSTS
RH 3.4 Map	18	543.8	UniSTS
Cytogenetic Map	18	q12.1	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053615	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039096533	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039096535	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039096536	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039096537	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039096538	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039096541	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277052	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277053	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277054	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277055	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC127486	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473971	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213166	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216364	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222279	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U77582	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U77583	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000044346 ⟹ ENSRNOP00000051516

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	55,017,055 - 55,049,271 (+)	Ensembl
Rnor_6.0 Ensembl	18	56,887,354 - 56,917,711 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000066133 ⟹ ENSRNOP00000062327

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	18	56,887,496 - 56,918,345 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000078783 ⟹ ENSRNOP00000072385

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	18	56,887,722 - 56,910,901 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000097100 ⟹ ENSRNOP00000085265

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	55,017,055 - 55,049,271 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000103047 ⟹ ENSRNOP00000082592

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	55,017,055 - 55,049,271 (+)	Ensembl

RefSeq Acc Id:

NM_053615 ⟹ NP_446067

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	57,287,412 - 57,318,551 (+)	NCBI
mRatBN7.2	18	55,017,053 - 55,048,195 (+)	NCBI
Rnor_6.0	18	56,887,722 - 56,910,610 (+)	NCBI
Rnor_5.0	18	56,116,635 - 56,139,523 (+)	NCBI
RGSC_v3.4	18	57,541,673 - 57,564,560 (+)	RGD
Celera	18	53,168,136 - 53,191,023 (+)	NCBI

Sequence:

show sequence

ATGGCGAGCAGCAGCGGCTCCAAGGCCGAATTTATCGTCGGTGGGAAATACAAACTGGTGCGGA
AGATCGGATCTGGTTCCTTCGGGGACATTTATCTAGCGATCAACATCACCAATGGCGAGGAAGT
GGCAGTGAAACTAGAATCCCAGAAGGCCAGGCATCCCCAGTTGCTGTACGAGAGCAAACTGTAT
AAGATTCTTCAAGGTGGGGTTGGCATCCCTCACATACGGTGGTATGGGCAAGGAAAAGACTATA
ATGTGCTAGTCATGGATCTTCTGGGACCCAGCCTCGAAGACCTCTTCAATTTCTGTTCAAGAAG
GTTCACTATGAAGACTGTACTTATGTTAGCTGACCAGATGATCAGTAGAATTGAATATGTGCAT
ACAAAGAATTTTATACACAGAGACATTAAACCAGATAACTTCCTAATGGGTATTGGGCGTCACT
GTAATAAGTTATTCCTTATTGATTTTGGTTTGGCCAAAAAGTACAGAGACAACAGGACAAGGCA
ACACATACCATACAGGGAAGATAAAAACCTCACTGGCACTGCCCGGTATGCCAGCATCAATGCA
CATCTTGGCATTGAGCAGAGTCGCCGAGATGACATGGAATCTTTAGGATATGTTTTGATGTATT
TTAATAGAACCAGTCTGCCATGGCAAGGGCTAAAGGCTGCAACAAAGAAACAAAAATATGAAAA
GATTAGTGAAAAGAAGATGTCCACTCCTGTTGAAGTTTTGTGTAAGGGGTTTCCTGCAGAATTT
GCCATGTACTTAAATTACTGTCGTGGGCTGCGCTTTGAGGAAGCTCCGGATTACATGTATCTGA
GGCAGCTGTTCCGCATCCTCTTCAGGACCCTGAACCACCAGTATGACTACACGTTTGATTGGAC
GATGTTAAAGCAGAAAGCAGCCCAGCAGGCAGCCTCTTCCAGTGGGCAGGGTCAGCAGGCCCAA
ACCCCCACAGGTTTCTAA

hide sequence

RefSeq Acc Id:

XM_039096533 ⟹ XP_038952461

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	57,287,340 - 57,315,929 (+)	NCBI
mRatBN7.2	18	55,017,049 - 55,043,822 (+)	NCBI

RefSeq Acc Id:

XM_039096535 ⟹ XP_038952463

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	57,287,340 - 57,320,540 (+)	NCBI
mRatBN7.2	18	55,017,051 - 55,050,184 (+)	NCBI

RefSeq Acc Id:

XM_039096536 ⟹ XP_038952464

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	57,287,340 - 57,320,540 (+)	NCBI
mRatBN7.2	18	55,017,049 - 55,043,822 (+)	NCBI

RefSeq Acc Id:

XM_039096537 ⟹ XP_038952465

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	57,287,340 - 57,320,540 (+)	NCBI
mRatBN7.2	18	55,017,051 - 55,050,184 (+)	NCBI

RefSeq Acc Id:

XM_039096538 ⟹ XP_038952466

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	57,287,325 - 57,320,540 (+)	NCBI
mRatBN7.2	18	55,017,054 - 55,043,822 (+)	NCBI

RefSeq Acc Id:

XM_039096541 ⟹ XP_038952469

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	57,287,325 - 57,320,540 (+)	NCBI
mRatBN7.2	18	55,017,054 - 55,050,184 (+)	NCBI

RefSeq Acc Id:

XM_063277052 ⟹ XP_063133122

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	57,287,340 - 57,320,540 (+)	NCBI

RefSeq Acc Id:

XM_063277053 ⟹ XP_063133123

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	57,287,340 - 57,320,540 (+)	NCBI

RefSeq Acc Id:

XM_063277054 ⟹ XP_063133124

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	57,287,325 - 57,320,540 (+)	NCBI

RefSeq Acc Id:

XM_063277055 ⟹ XP_063133125

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	57,285,156 - 57,320,540 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_446067	(Get FASTA)	NCBI Sequence Viewer
	XP_038952461	(Get FASTA)	NCBI Sequence Viewer
	XP_038952463	(Get FASTA)	NCBI Sequence Viewer
	XP_038952464	(Get FASTA)	NCBI Sequence Viewer
	XP_038952465	(Get FASTA)	NCBI Sequence Viewer
	XP_038952466	(Get FASTA)	NCBI Sequence Viewer
	XP_038952469	(Get FASTA)	NCBI Sequence Viewer
	XP_063133122	(Get FASTA)	NCBI Sequence Viewer
	XP_063133123	(Get FASTA)	NCBI Sequence Viewer
	XP_063133124	(Get FASTA)	NCBI Sequence Viewer
	XP_063133125	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB19227	(Get FASTA)	NCBI Sequence Viewer
	AAB19228	(Get FASTA)	NCBI Sequence Viewer
	AAI27487	(Get FASTA)	NCBI Sequence Viewer
	EDM14605	(Get FASTA)	NCBI Sequence Viewer
	EDM14606	(Get FASTA)	NCBI Sequence Viewer
	EDM14607	(Get FASTA)	NCBI Sequence Viewer
	EDM14608	(Get FASTA)	NCBI Sequence Viewer
	EDM14609	(Get FASTA)	NCBI Sequence Viewer
	EDM14610	(Get FASTA)	NCBI Sequence Viewer
	EDM14611	(Get FASTA)	NCBI Sequence Viewer
	EDM14612	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000051516.3
	ENSRNOP00000082592
	ENSRNOP00000082592.1
	ENSRNOP00000085265
	ENSRNOP00000085265.1
GenBank Protein	P97633	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_446067 ⟸ NM_053615

- UniProtKB:

A0JPL2 (UniProtKB/TrEMBL), A6IXH5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLY
KILQGGVGIPHIRWYGQGKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVH
TKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINA
HLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEF
AMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQ
TPTGF

hide sequence

RefSeq Acc Id:

ENSRNOP00000062327 ⟸ ENSRNOT00000066133

RefSeq Acc Id:

ENSRNOP00000051516 ⟸ ENSRNOT00000044346

RefSeq Acc Id:

ENSRNOP00000072385 ⟸ ENSRNOT00000078783

RefSeq Acc Id:	XP_038952461 ⟸ XM_039096533
- Peptide Label:	isoform X1
- UniProtKB:	A6IXH5 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038952464 ⟸ XM_039096536
- Peptide Label:	isoform X4
- UniProtKB:	P97634 (UniProtKB/Swiss-Prot), P97633 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_038952463 ⟸ XM_039096535
- Peptide Label:	isoform X3
- UniProtKB:	A6IXH5 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038952465 ⟸ XM_039096537
- Peptide Label:	isoform X5
- UniProtKB:	P97634 (UniProtKB/Swiss-Prot), P97633 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_038952469 ⟸ XM_039096541
- Peptide Label:	isoform X9
- UniProtKB:	P97634 (UniProtKB/Swiss-Prot), P97633 (UniProtKB/Swiss-Prot), A6IXH7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038952466 ⟸ XM_039096538
- Peptide Label:	isoform X6
- UniProtKB:	A6IXH5 (UniProtKB/TrEMBL)

RefSeq Acc Id:

ENSRNOP00000085265 ⟸ ENSRNOT00000097100

RefSeq Acc Id:

ENSRNOP00000082592 ⟸ ENSRNOT00000103047

RefSeq Acc Id:	XP_063133125 ⟸ XM_063277055
- Peptide Label:	isoform X8
- UniProtKB:	D3ZRE3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063133124 ⟸ XM_063277054
- Peptide Label:	isoform X7

RefSeq Acc Id:	XP_063133122 ⟸ XM_063277052
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063133123 ⟸ XM_063277053
- Peptide Label:	isoform X2

Protein Domains

Protein kinase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P97633-F1-model_v2	AlphaFold	P97633	1-325	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700823

Promoter ID:

EPDNEW_R11341

Type:

initiation region

Name:

Csnk1a1_1

Description:

casein kinase 1, alpha 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	18	56,887,263 - 56,887,323	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:71098	AgrOrtholog
BioCyc Gene	G2FUF-7324	BioCyc
Ensembl Genes	ENSRNOG00000017106	Ensembl
	ENSRNOG00000063313	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000044346.6	UniProtKB/TrEMBL
	ENSRNOT00000097100.1	UniProtKB/TrEMBL
	ENSRNOT00000103047.1	UniProtKB/TrEMBL
Gene3D-CATH	Transferase(Phosphotransferase) domain 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:8364080	IMAGE-MGC_LOAD
InterPro	Kinase-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Pkinase_fungal	UniProtKB/TrEMBL
	Prot_kinase_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Protein_kinase_ATP_BS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ser/Thr_kinase_AS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:113927	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:156603	IMAGE-MGC_LOAD
NCBI Gene	113927	ENTREZGENE
PANTHER	CASEIN KINASE I ISOFORM ALPHA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CASEIN KINASE-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Pkinase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Pkinase_fungal	UniProtKB/TrEMBL
PhenoGen	Csnk1a1	PhenoGen
PROSITE	PROTEIN_KINASE_ATP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PROTEIN_KINASE_DOM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PROTEIN_KINASE_ST	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000017106	RatGTEx
	ENSRNOG00000063313	RatGTEx
SMART	S_TKc	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF56112	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5ZV66_RAT	UniProtKB/TrEMBL
	A0A8I6GCP2_RAT	UniProtKB/TrEMBL
	A0JPL2	ENTREZGENE, UniProtKB/TrEMBL
	A6IXH4_RAT	UniProtKB/TrEMBL
	A6IXH5	ENTREZGENE, UniProtKB/TrEMBL
	A6IXH7	ENTREZGENE, UniProtKB/TrEMBL
	A6IXH9_RAT	UniProtKB/TrEMBL
	A6IXI0_RAT	UniProtKB/TrEMBL
	A6IXI1_RAT	UniProtKB/TrEMBL
	D3ZRE3	ENTREZGENE, UniProtKB/TrEMBL
	KC1A_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	P97634	ENTREZGENE
UniProt Secondary	P97634	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-07-09	Csnk1a1	casein kinase 1, alpha 1			Symbol and Name updated to reflect Human and Mouse nomenclature	70877	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_protein	splice variant CKI alpha L contains an insertion within the catalytic site	70700
gene_transcript	CKI alpha and CKI alpha L are alternatively spliced isoforms	70700

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)