Kynu (kynureninase) - Rat Genome Database

Name: Kynu
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Kynu (kynureninase) Rattus norvegicus

Analyze

Symbol:

Kynu

Name:

kynureninase

RGD ID:

71061

Description:

Enables kynureninase activity and pyridoxal phosphate binding activity. Involved in tryptophan catabolic process to acetyl-CoA. Predicted to be located in cytosol; mitochondrion; and nucleoplasm. Predicted to be active in cytoplasm. Used to study hypertension. Human ortholog(s) of this gene implicated in hydroxykynureninuria. Orthologous to human KYNU (kynureninase); PARTICIPATES IN tryptophan metabolic pathway; kynurenine metabolic pathway; INTERACTS WITH (+)-schisandrin B; 1-benzylpiperazine; 1-naphthyl isothiocyanate.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

kynureninase (L-kynurenine hydrolase); L-kynurenine hydrolase

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	KYNU (kynureninase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Kynu (kynureninase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Kynu (kynureninase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	KYNU (kynureninase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	KYNU (kynureninase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Kynu (kynureninase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	KYNU (kynureninase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	KYNU (kynureninase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Kynu (kynureninase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	KYNU (kynureninase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Kynu (kynureninase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	kynu (kynureninase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	BNA5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	kynu-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Is Marker For:

QTLs: Bp140

Candidate Gene For:

Bp140

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	48,188,286 - 48,338,996 (+)	NCBI		GRCr8
mRatBN7.2	3	27,778,646 - 27,929,470 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	27,778,772 - 27,929,488 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	31,169,534 - 31,320,227 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	39,754,563 - 39,905,257 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	37,572,172 - 37,723,939 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	28,416,926 - 28,566,939 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	28,416,954 - 28,566,928 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	33,622,141 - 33,770,793 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	24,046,242 - 24,195,898 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	23,942,613 - 24,092,267 (+)	NCBI
Celera	3	26,096,675 - 26,244,576 (+)	NCBI		Celera
Cytogenetic Map	3	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal dominant intellectual developmental disorder 1 (ISO)

Catel Manzke syndrome (ISO)

Experimental Liver Cirrhosis (ISO)

genetic disease (ISO)

hydroxykynureninuria (ISO)

hypertension (IAGP)

Inflammation (ISO)

Mowat-Wilson syndrome (ISO)

neurodegenerative disease (ISO)

Vertebral, Cardiac, Renal, and Limb Defects Syndrome 2 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(-)-demecolcine (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

1-benzylpiperazine (EXP)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3-chloropropane-1,2-diol (EXP)

4,4'-diaminodiphenylmethane (EXP)

acetamide (EXP)

aflatoxin B1 (ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsenous acid (ISO)

atazanavir sulfate (ISO)

azathioprine (ISO)

benzo[a]pyrene (ISO)

beta-naphthoflavone (EXP,ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

buta-1,3-diene (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP)

cantharidin (ISO)

carbon nanotube (ISO)

chenodeoxycholic acid (ISO)

chloropicrin (ISO)

cisplatin (ISO)

clomiphene (ISO)

cobalt dichloride (ISO)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

copper(II) sulfate (ISO)

coumarin (EXP)

crocidolite asbestos (ISO)

curcumin (ISO)

cyanocob(III)alamin (EXP)

cyclosporin A (ISO)

cypermethrin (ISO)

cytarabine (ISO)

D-glucose (ISO)

deoxycholic acid (ISO)

diarsenic trioxide (ISO)

dicrotophos (ISO)

diethylstilbestrol (ISO)

diquat (ISO)

dorsomorphin (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

estrone (ISO)

etoposide (ISO)

fenvalerate (ISO)

flavonoids (EXP)

flutamide (EXP)

folic acid (EXP)

fructose (ISO)

fulvestrant (ISO)

furan (EXP)

gamma-linolenic acid (ISO)

genistein (ISO)

glafenine (EXP)

glucose (ISO)

glycidyl methacrylate (ISO)

glycochenodeoxycholic acid (ISO)

glycocholic acid (ISO)

glycodeoxycholic acid (ISO)

gold atom (ISO)

gold(0) (ISO)

GW 4064 (ISO)

hexestrol (ISO)

hydrogen peroxide (ISO)

indometacin (EXP)

ivermectin (ISO)

kynurenine (ISO)

lamivudine (ISO)

lipopolysaccharide (ISO)

menadione (ISO)

mercury dichloride (EXP)

mestranol (ISO)

methamphetamine (ISO)

methapyrilene (EXP)

methomyl (ISO)

methylmercury chloride (ISO)

N,N-diethyl-m-toluamide (EXP)

N-nitrosodiethylamine (EXP)

N-nitrosodimethylamine (EXP)

nefazodone (EXP,ISO)

nickel atom (ISO)

nickel dichloride (ISO)

nickel sulfate (ISO)

nimesulide (EXP)

nitroglycerin (EXP)

ozone (ISO)

p-toluidine (EXP)

paracetamol (ISO)

paraquat (ISO)

perfluorooctane-1-sulfonic acid (EXP,ISO)

perfluorooctanoic acid (EXP,ISO)

permethrin (EXP)

phenobarbital (ISO)

phenylmercury acetate (ISO)

PhIP (EXP)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

progesterone (ISO)

resveratrol (EXP,ISO)

rotenone (EXP,ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

serpentine asbestos (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

streptozocin (EXP)

sulforaphane (ISO)

tamoxifen (ISO)

temozolomide (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

triphenyl phosphate (EXP)

troglitazone (ISO)

urethane (ISO)

valproic acid (EXP,ISO)

vancomycin (ISO)

vinclozolin (EXP)

vincristine (ISO)

zidovudine (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

'de novo' NAD biosynthetic process from tryptophan (IEA)

anthranilate metabolic process (IBA,IEA,ISO)

L-kynurenine catabolic process (IEA)

NAD biosynthetic process (ISO,ISS)

quinolinate biosynthetic process (IEA,ISO)

response to type II interferon (ISO)

response to vitamin B6 (ISO)

tryptophan catabolic process (ISO)

tryptophan catabolic process to acetyl-CoA (IDA)

tryptophan catabolic process to kynurenine (IBA,IEA)

Cellular Component

cytoplasm (IBA,IEA)

cytosol (ISO)

mitochondrion (ISO)

nucleoplasm (ISO)

Molecular Function

3-hydroxykynureninase activity (ISO,ISS)

kynureninase activity (IBA,IDA,IEA,ISO)

protein binding (ISO)

protein homodimerization activity (ISO)

pyridoxal phosphate binding (IDA,IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

kynurenine metabolic pathway (ISO)

tryptophan metabolic pathway (IDA,IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The effect of age on the enzyme activities of tryptophan metabolism along the kynurenine pathway in rats.	Comai S, etal., Clin Chim Acta. 2005 Oct;360(1-2):67-80. doi: 10.1016/j.cccn.2005.04.013.
2.	Expression of kynurenine aminotransferase in the subplate of the rat and its possible role in the regulation of programmed cell death.	Csillik AE, etal., Cereb Cortex 2002 Nov;12(11):1193-201.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	A missense mutation in kynurenine aminotransferase-1 in spontaneously hypertensive rats.	Kwok JB, etal., J Biol Chem 2002 Sep 27;277(39):35779-82.
6.	The kynurenine pathway and neurodegenerative disease.	Maddison DC and Giorgini F, Semin Cell Dev Biol. 2015 Apr;40:134-41. doi: 10.1016/j.semcdb.2015.03.002. Epub 2015 Mar 12.
7.	Gene Data Set	MGD Curation, June 12, 2002
8.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
9.	Kynureninase is a novel candidate gene for hypertension in spontaneously hypertensive rats.	Mizutan K, etal., Hypertens Res 2002 Jan;25(1):135-40.
10.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.	Enzymatic studies on tryptophan metabolism disorder in rats chronically exposed to carbon disulfide.	Okayama A, etal., Toxicol Appl Pharmacol. 1988 Jul;94(3):356-61.
12.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
13.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
14.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
15.	GOA pipeline	RGD automated data pipeline
16.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
17.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
18.	The metabolism of L-tryptophan by isolated rat liver cells. Quantification of the relative importance of, and the effect of nutritional status on, the individual pathways of tryptophan metabolism.	Smith SA, etal., Biochem J. 1980 Nov 15;192(2):673-86.
19.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
20.	Kynurenine metabolism in vitamin-B-6-deficient rat liver after tryptophan injection.	Takeuchi F and Shibata Y, Biochem J. 1984 Jun 15;220(3):693-9.
21.	Purification and properties of kynureninase from rat liver.	Takeuchi F, etal., J Biochem. 1980 Oct;88(4):987-94.
22.	Cloning and recombinant expression of rat and human kynureninase.	Toma S, etal., FEBS Lett 1997 May 12;408(1):5-10.

Additional References at PubMed

PMID:1939450	PMID:6468727	PMID:7578221	PMID:8706755	PMID:9291104	PMID:11985583	PMID:15489334	PMID:17334708	PMID:18614015	PMID:28792876

Genomics

Comparative Map Data

Kynu
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	48,188,286 - 48,338,996 (+)	NCBI		GRCr8
mRatBN7.2	3	27,778,646 - 27,929,470 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	27,778,772 - 27,929,488 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	31,169,534 - 31,320,227 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	39,754,563 - 39,905,257 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	37,572,172 - 37,723,939 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	28,416,926 - 28,566,939 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	28,416,954 - 28,566,928 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	33,622,141 - 33,770,793 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	24,046,242 - 24,195,898 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	23,942,613 - 24,092,267 (+)	NCBI
Celera	3	26,096,675 - 26,244,576 (+)	NCBI		Celera
Cytogenetic Map	3	q12	NCBI

KYNU
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	142,877,664 - 143,055,833 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	142,877,657 - 143,055,833 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	143,635,233 - 143,813,402 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	143,351,665 - 143,516,355 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	143,468,950 - 143,633,606	NCBI
Celera	2	137,347,656 - 137,512,293 (+)	NCBI		Celera
Cytogenetic Map	2	q22.2	NCBI
HuRef	2	135,626,307 - 135,791,074 (+)	NCBI		HuRef
CHM1_1	2	143,640,202 - 143,804,900 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	143,325,958 - 143,504,091 (+)	NCBI		T2T-CHM13v2.0

Kynu
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	43,445,270 - 43,572,734 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	43,445,341 - 43,572,734 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	43,555,258 - 43,683,048 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	43,555,329 - 43,682,715 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	43,410,849 - 43,538,235 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	43,377,338 - 43,504,724 (+)	NCBI		MGSCv36	mm8
Celera	2	45,275,609 - 45,403,071 (+)	NCBI		Celera
Cytogenetic Map	2	B	NCBI
cM Map	2	25.64	NCBI

Kynu
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955440	9,420,009 - 9,536,761 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955440	9,420,141 - 9,536,767 (+)	NCBI	ChiLan1.0	ChiLan1.0

KYNU
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	31,861,346 - 32,151,868 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	31,876,156 - 32,166,772 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	16,792,401 - 16,947,766 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	146,976,053 - 147,131,298 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	146,975,995 - 147,132,634 (+)	Ensembl	panpan1.1		panPan2

KYNU
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	19	45,022,450 - 45,150,977 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	19	45,022,072 - 45,149,339 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	19	45,274,902 - 45,404,061 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	19	46,479,473 - 46,607,767 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	19	46,479,626 - 46,607,752 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	19	45,139,690 - 45,268,624 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	19	45,269,758 - 45,399,409 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	19	46,664,690 - 46,794,435 (+)	NCBI		UU_Cfam_GSD_1.0

Kynu
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	107,812,529 - 107,984,835 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936469	33,632,892 - 33,734,433 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936469	33,632,885 - 33,805,158 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

KYNU
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	8,850,544 - 8,982,891 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	15	8,847,335 - 8,982,951 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	9,760,379 - 9,821,853 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

KYNU
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	28,230,129 - 28,394,103 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	28,230,508 - 28,394,076 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	171,182,800 - 171,346,370 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Kynu
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624732	42,627,715 - 42,753,165 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624732	42,627,789 - 42,751,037 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Kynu
1226 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	32
Count of miRNA genes:	24
Interacting mature miRNAs:	28
Transcripts:	ENSRNOT00000043533
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631679	Cm10	Cardiac mass QTL 10	7.34	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	1	31158234	Rat
631831	Alc8	Alcohol consumption QTL 8	2.7		consumption behavior trait (VT:0002069)	calculated ethanol drink intake rate (CMO:0001615)	3	1	33230976	Rat
61468	Bp15	Blood pressure QTL 15	4.4		blood pressure trait (VT:0000183)	diastolic blood pressure (CMO:0000005)	3	1	33278763	Rat
61468	Bp15	Blood pressure QTL 15	4.4		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	3	1	33278763	Rat
61468	Bp15	Blood pressure QTL 15	4.4		blood pressure trait (VT:0000183)	pulse pressure (CMO:0000292)	3	1	33278763	Rat
631545	Bp85	Blood pressure QTL 85	3.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	1	33278763	Rat
4889966	Bss95	Bone structure and strength QTL 95	4.4		tibia area (VT:1000281)	tibia-fibula cross-sectional area (CMO:0001718)	3	1	36847613	Rat
2312664	Scl62	Serum cholesterol level QTL 62		0.05	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	1	38710544	Rat
631568	Bp92	Blood pressure QTL 92	2.2	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	1	39874793	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
1298526	Arunc3	Aerobic running capacity QTL 3	2.2		exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	8227194	33703538	Rat
10401810	Kidm53	Kidney mass QTL 53			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	8227194	47233430	Rat
6893355	Bw101	Body weight QTL 101	0.4	0.38	body mass (VT:0001259)	body weight (CMO:0000012)	3	10778704	30357018	Rat
6893363	Bw105	Body weight QTL 105	2.6	0.0036	body mass (VT:0001259)	body weight (CMO:0000012)	3	10778704	30357018	Rat
1558654	Bw56	Body weight QTL 56	4.5	0.0000171	body mass (VT:0001259)	body weight (CMO:0000012)	3	10778704	30357018	Rat
70191	BpQTLcluster4	Blood pressure QTL cluster 4	3		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	3	10778704	50302886	Rat
70191	BpQTLcluster4	Blood pressure QTL cluster 4	3		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	3	10778704	50302886	Rat
1558647	Cm46	Cardiac mass QTL 46	5.4	0.0000055	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	10778823	30356773	Rat
1558650	Cm48	Cardiac mass QTL 48	4	0.0001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	3	10778823	30356773	Rat
1558657	Cm43	Cardiac mass QTL 43	6.6	0.0000000293	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	10778823	30356773	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	10861912	89878372	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	15005422	76927699	Rat
631676	Cm8	Cardiac mass QTL 8	7.03	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	3	16954708	61954708	Rat
634306	Bp140	Blood pressure QTL 140	3.3	0.0013	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	17374703	35528639	Rat
634306	Bp140	Blood pressure QTL 140	3.3	0.0013	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	17374703	35528639	Rat
634306	Bp140	Blood pressure QTL 140	3.3	0.0013	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	3	17374703	35528639	Rat
634306	Bp140	Blood pressure QTL 140	3.3	0.0013	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	3	17374703	35528639	Rat
634306	Bp140	Blood pressure QTL 140	3.3	0.0013	arterial blood pressure trait (VT:2000000)	heart rate (CMO:0000002)	3	17374703	35528639	Rat
634306	Bp140	Blood pressure QTL 140	3.3	0.0013	arterial blood pressure trait (VT:2000000)	heart rate (CMO:0000002)	3	17374703	35528639	Rat
634306	Bp140	Blood pressure QTL 140	3.3	0.0013	arterial blood pressure trait (VT:2000000)	body weight (CMO:0000012)	3	17374703	35528639	Rat
634306	Bp140	Blood pressure QTL 140	3.3	0.0013	arterial blood pressure trait (VT:2000000)	body weight (CMO:0000012)	3	17374703	35528639	Rat
2325840	Bp345	Blood pressure QTL 345		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	18311454	28441896	Rat
731172	Bp151	Blood pressure QTL 151		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	18311454	47233430	Rat
12879849	Bw180	Body weight QTL 180		0.037	body mass (VT:0001259)	body weight (CMO:0000012)	3	18311454	47233430	Rat
12879850	Cm91	Cardiac mass QTL 91		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	18311454	47233430	Rat
12879851	Cm92	Cardiac mass QTL 92		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	18311454	47233430	Rat
12879852	Cm93	Cardiac mass QTL 93		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	18311454	47233430	Rat
12879853	Am5	Aortic mass QTL 5		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	18311454	47233430	Rat
12879854	Kidm63	Kidney mass QTL 63		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	18311454	47233430	Rat
10450804	Scl70	Serum cholesterol level QTL 70	4.7	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	20714090	65714090	Rat
10450794	Scl69	Serum cholesterol level QTL 69	6.3	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	20714090	65714090	Rat
1298073	Cm13	Cardiac mass QTL 13	2.5		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	25013911	38192233	Rat
631832	Sach1	Saccharin preference QTL 1	2.7	0.02	consumption behavior trait (VT:0002069)	calculated saccharin drink intake volume (CMO:0001600)	3	27494621	44188411	Rat
2313049	Bss72	Bone structure and strength QTL 72	2.6	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	3	27494621	50302886	Rat
2313076	Bss74	Bone structure and strength QTL 74	2	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	3	27494621	50302886	Rat
2313079	Bss73	Bone structure and strength QTL 73	1.5		tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	3	27494621	50302886	Rat
2313093	Bmd77	Bone mineral density QTL 77	2.2	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	3	27494621	50302886	Rat
2313101	Bmd76	Bone mineral density QTL 76	3.6	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	3	27494621	50302886	Rat

Markers in Region

RH140553

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	27,859,860 - 27,860,058 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	28,497,302 - 28,497,499	NCBI	Rnor6.0
Rnor_5.0	3	33,700,461 - 33,700,658	UniSTS	Rnor5.0
RGSC_v3.4	3	24,125,532 - 24,125,729	UniSTS	RGSC3.4
Celera	3	26,175,593 - 26,175,790	UniSTS
Cytogenetic Map	3	q12	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	2		35	35	8	35				21
Low			22	6	11	6	3	3	3	14	32	10	3
Below cutoff	1	14					5	5	33		8	1	5

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053902	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006234138	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008761695	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC108252	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC078762	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473983	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U68168	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000043533 ⟹ ENSRNOP00000050947

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	27,778,772 - 27,929,488 (+)	Ensembl
Rnor_6.0 Ensembl	3	28,416,954 - 28,566,928 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000097426 ⟹ ENSRNOP00000084707

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	27,778,772 - 27,929,488 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000113563 ⟹ ENSRNOP00000082004

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	27,778,772 - 27,929,488 (+)	Ensembl

RefSeq Acc Id:

NM_053902 ⟹ NP_446354

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	48,188,286 - 48,338,996 (+)	NCBI
mRatBN7.2	3	27,778,755 - 27,929,470 (+)	NCBI
Rnor_6.0	3	28,416,989 - 28,566,919 (+)	NCBI
Rnor_5.0	3	33,622,141 - 33,770,793 (+)	NCBI
RGSC_v3.4	3	24,046,242 - 24,195,898 (+)	RGD
Celera	3	26,096,675 - 26,244,576 (+)	RGD

Sequence:

show sequence

TGAAAAGGTACTGGAAACTGAGGACCCTATCTGGATCAAAGCAGTTTCTGATGGAGCCCTCGCC
TCTTGAGCTACCAGTTGATGCAGTGCGGCGCATCGCGGCTGAACTCAATTGTGACCCAACCGAT
GAGAGGGTGGCTCTCCGCTTGGATGAGGAAGATAAACTGAAGCGTTTTAAGGACTGTTTTTATA
TCCCCAAAATGCGGGACCTGCCTTCAATTGATCTATCTTTAGTGAATGAGGATGATAATGCCAT
CTATTTCCTGGGAAATTCCCTTGGTCTTCAACCGAAGATGGTTAAAACATACCTGGAGGAAGAG
CTAGATAAGTGGGCCAAAATAGGAGCCTATGGCCATGAGGTAGGGAAACGTCCTTGGATTATAG
GAGATGAGAGCATTGTAACCCTTATGAAGGACATTGTAGGAGCCCATGAGAAAGAAATAGCTCT
AATGAATGCTTTGACTGTTAATTTACATCTCCTGCTGTTATCATTCTTTAAGCCTACACCAAAG
CGGCACAAAATTCTTCTAGAAGCCAAAGCCTTCCCTTCTGATCATTATGCGATCGAGTCACAGA
TTCAACTTCATGGACTTGATGTTGAGAAAAGTATGCGGATGATAAAGCCACGAGAGGGGGAAGA
GACCTTAAGAATGGAGGACATACTGGAAGTAATTGAGAAGGAAGGAGACTCAATTGCTGTGGTC
CTGTTCAGTGGCCTGCACTTTTATACTGGACAGCTGTTCAACATTCCTGCCATTACACAAGCCG
GACATGCAAAGGGCTGTTTTGTTGGCTTTGACCTAGCGCATGCGGTTGGAAATGTTGAACTCCA
CTTACATGACTGGGATGTTGACTTTGCCTGCTGGTGCTCCTACAAGTATTTAAATTCAGGAGCT
GGAGGTCTGGCTGGTGCCTTCATCCATGAGAAACACGCTCACACGATCAAGCCAGCGTTAGTGG
GATGGTTCGGCCATGAACTCAGTACAAGATTTAACATGGATAACAAACTACAATTAATCCCCGG
GGTCAATGGATTCCGAATTTCCAACCCTCCCATTCTGTTGGTCTGCTCCTTGCATGCCAGTTTA
GAGATCTTTCAGCAAGCAACTATGACTGCGCTGAGGAGAAAATCCATTCTGCTGACAGGTTATC
TGGAATACTTGCTCAAACATTACCATGGCGGAAATGACACAGAAAACAAGAGGCCAGTTGTGAA
CATAATCACCCCATCCAGAGCAGAGGAACGAGGCTGCCAGCTGACACTGACCTTTTCCATTTCC
AAGAAAGGCGTTTTTAAGGAACTAGAAAAAAGAGGAGTCGTCTGTGACAAGCGAGAACCAGAAG
GCATCCGGGTGGCCCCGGTTCCTCTCTATAATTCTTTCCATGATGTTTATAAGTTCATCAGACT
GCTTACTGCCATACTCGACTCTACAGAAAGAAACTAGCCATGCTTTCTAAATAACTCAAGTAAA
TCTCACACACTGGGGGTTCCACTTCTACTGCATTTTAGTCATTCAAAAGTCTCCAGAAATTGAT
GGCATAGAAATGATGATGATTTTATAAACTTACATAAAACCTGGTACATGTTTTAATATCTGTG
TCGCTGATGTGCTGTGGACTAAGAAGTCACATTTTACATGACTCCAACCTACAGATGACTGTCT
TGATCAGCTGTCACCTTCCATGGTCACTGAAAGGTTGTGTGTTTAATTTGTGACTGAAATGACA
ACATTAAAATGTATCTGGACTTCTTGTATAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_446354	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC53206	(Get FASTA)	NCBI Sequence Viewer
	AAH78762	(Get FASTA)	NCBI Sequence Viewer
	EDM00489	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000050947
	ENSRNOP00000050947.4
	ENSRNOP00000082004.1
	ENSRNOP00000084707.1
GenBank Protein	P70712	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_446354 ⟸ NM_053902

- UniProtKB:

Q9QW90 (UniProtKB/Swiss-Prot), Q7M0D0 (UniProtKB/Swiss-Prot), Q68G25 (UniProtKB/Swiss-Prot), P70712 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MEPSPLELPVDAVRRIAAELNCDPTDERVALRLDEEDKLKRFKDCFYIPKMRDLPSIDLSLVNE
DDNAIYFLGNSLGLQPKMVKTYLEEELDKWAKIGAYGHEVGKRPWIIGDESIVTLMKDIVGAHE
KEIALMNALTVNLHLLLLSFFKPTPKRHKILLEAKAFPSDHYAIESQIQLHGLDVEKSMRMIKP
REGEETLRMEDILEVIEKEGDSIAVVLFSGLHFYTGQLFNIPAITQAGHAKGCFVGFDLAHAVG
NVELHLHDWDVDFACWCSYKYLNSGAGGLAGAFIHEKHAHTIKPALVGWFGHELSTRFNMDNKL
QLIPGVNGFRISNPPILLVCSLHASLEIFQQATMTALRRKSILLTGYLEYLLKHYHGGNDTENK
RPVVNIITPSRAEERGCQLTLTFSISKKGVFKELEKRGVVCDKREPEGIRVAPVPLYNSFHDVY
KFIRLLTAILDSTERN

hide sequence

RefSeq Acc Id:

ENSRNOP00000050947 ⟸ ENSRNOT00000043533

RefSeq Acc Id:

ENSRNOP00000082004 ⟸ ENSRNOT00000113563

RefSeq Acc Id:

ENSRNOP00000084707 ⟸ ENSRNOT00000097426

Protein Domains

Aminotransferase class V

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P70712-F1-model_v2	AlphaFold	P70712	1-464	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692061

Promoter ID:

EPDNEW_R2586

Type:

initiation region

Name:

Kynu_1

Description:

kynureninase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	28,417,003 - 28,417,063	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:71061	AgrOrtholog
BioCyc Gene	G2FUF-49851	BioCyc
BioCyc Pathway	PWY-5651 [L-tryptophan degradation to 2-amino-3-carboxymuconate semialdehyde]	BioCyc
BioCyc Pathway Image	PWY-5651	BioCyc
Ensembl Genes	ENSRNOG00000029993	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000043533	ENTREZGENE
	ENSRNOT00000043533.5	UniProtKB/TrEMBL
	ENSRNOT00000097426.1	UniProtKB/TrEMBL
	ENSRNOT00000113563.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.640.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	3.90.1150.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7128911	IMAGE-MGC_LOAD
InterPro	Aminotrans_V_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Kynureninase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PyrdxlP-dep_Trfase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PyrdxlP-dep_Trfase_dom1	UniProtKB/Swiss-Prot
	PyrdxlP-dep_Trfase_major	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PyrdxlP-dep_Trfase_small	UniProtKB/TrEMBL
KEGG Report	rno:116682	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93273	IMAGE-MGC_LOAD
NCBI Gene	116682	ENTREZGENE
PANTHER	KYNURENINASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR14084	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Aminotran_5	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Kynu	PhenoGen
PIRSF	KYNU	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000029993	RatGTEx
Superfamily-SCOP	SSF53383	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5ZW86_RAT	UniProtKB/TrEMBL
	A0A8I6A2I1_RAT	UniProtKB/TrEMBL
	A0A8L2QQS0_RAT	UniProtKB/TrEMBL
	A6JEX1_RAT	UniProtKB/TrEMBL
	KYNU_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q68G25	ENTREZGENE
	Q7M0D0	ENTREZGENE
	Q9QW90	ENTREZGENE
UniProt Secondary	Q68G25	UniProtKB/Swiss-Prot
	Q7M0D0	UniProtKB/Swiss-Prot
	Q9QW90	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-08-02	Kynu	kynureninase	Kynu	kynureninase (L-kynurenine hydrolase)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-07-09	Kynu	kynureninase (L-kynurenine hydrolase)			Symbol and Name updated to reflect Human and Mouse nomenclature	70877	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	mRNA expression level in the brainstem higher in the spontaneously hypertensive rats (SHR) than in the WKY	631322
gene_function	metabolizes kynurenine into anthranilic acid	631322
gene_function	has cysteine-conjugate beta-lyase activity	70787
gene_protein	consists of 464 amino acids	70787

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways