Ech1 (enoyl-CoA hydratase 1) - Rat Genome Database

Name: Ech1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Ech1 (enoyl-CoA hydratase 1) Rattus norvegicus

Analyze

Symbol:

Ech1

Name:

enoyl-CoA hydratase 1

RGD ID:

69353

Description:

Predicted to enable delta(3,5)-delta(2,4)-dienoyl-CoA isomerase activity. Predicted to be involved in fatty acid beta-oxidation. Located in mitochondrion. Orthologous to human ECH1 (enoyl-CoA hydratase 1); INTERACTS WITH (+)-schisandrin B; 1,2,4-trimethylbenzene; 1-bromopropane.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial; enoyl CoA hydratase 1, peroxisomal; enoyl coenzyme A hydratase 1; enoyl coenzyme A hydratase 1, peroxisomal; enoyl hydratase-like protein peroxisomal; enoyl hydratase-like protein, peroxisomal; Peroxisomal enoyl hydratase-like protein; Pxel

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ECH1 (enoyl-CoA hydratase 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ech1 (enoyl coenzyme A hydratase 1, peroxisomal)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ech1 (enoyl-CoA hydratase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LOC100980944 (delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ECH1 (enoyl-CoA hydratase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ech1 (enoyl-CoA hydratase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ECH1 (enoyl-CoA hydratase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ECH1 (enoyl-CoA hydratase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ech1 (enoyl-CoA hydratase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ECH1 (enoyl-CoA hydratase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ech1 (enoyl coenzyme A hydratase 1, peroxisomal)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ech1 (enoyl CoA hydratase 1, peroxisomal)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	F58A6.1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG9577	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y25C1A.13	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ech1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	93,241,076 - 93,248,314 (+)	NCBI		GRCr8
mRatBN7.2	1	84,114,494 - 84,120,788 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	84,112,751 - 84,120,795 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	89,524,636 - 89,530,833 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	97,983,698 - 97,989,944 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	91,280,494 - 91,286,691 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	87,009,798 - 87,015,996 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	87,009,730 - 87,016,005 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	88,190,416 - 88,196,614 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	83,932,720 - 83,938,918 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	84,010,830 - 84,017,029 (+)	NCBI
Celera	1	78,504,909 - 78,511,107 (+)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

glucose intolerance (ISO)

Insulin Resistance (ISO)

maturity-onset diabetes of the young type 1 (ISO)

metabolic dysfunction-associated steatotic liver disease (ISO)

obesity (ISO)

type 2 diabetes mellitus (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-dexrazoxane (ISO)

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,2,4-trimethylbenzene (EXP)

1,2-dimethylhydrazine (ISO)

1-bromopropane (EXP)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

2,4-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

2-methyl-2-[4-(1,2,3,4-tetrahydronaphthalen-1-yl)phenoxy]propanoic acid (EXP)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3,3',4,4'-tetrachlorobiphenyl (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3,3',5-triiodo-L-thyronine (EXP)

3H-1,2-dithiole-3-thione (EXP)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

7H-xanthine (EXP)

9H-xanthine (EXP)

acetamide (EXP)

acrolein (ISO)

aflatoxin B1 (EXP)

alpha-pinene (ISO)

amiodarone (ISO)

amitrole (EXP)

ammonium chloride (EXP)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bexarotene (EXP)

bezafibrate (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

bleomycin A2 (EXP)

buspirone (EXP)

cadmium dichloride (EXP)

carbon nanotube (ISO)

chlorpyrifos (ISO)

choline (ISO)

chromium trinitrate (ISO)

ciprofibrate (EXP)

cisplatin (EXP)

clofibrate (EXP,ISO)

cobalt dichloride (EXP,ISO)

copper(II) sulfate (ISO)

Cuprizon (EXP)

curcumin (EXP)

cyclosporin A (ISO)

decabromodiphenyl ether (EXP,ISO)

diarsenic trioxide (ISO)

diazinon (EXP)

dibutyl phthalate (EXP)

dichloroacetic acid (ISO)

disodium selenite (ISO)

diuron (EXP)

doxorubicin (ISO)

endosulfan (EXP)

ethanol (EXP,ISO)

farnesol (ISO)

fenofibrate (EXP,ISO)

fenvalerate (EXP)

flavonoids (EXP)

flutamide (EXP,ISO)

folic acid (ISO)

FR900359 (ISO)

gemfibrozil (EXP)

genistein (ISO)

gentamycin (EXP)

gliotoxin (EXP)

GW 4064 (ISO)

GW 501516 (ISO)

GW 7647 (ISO)

hydroxyurea (ISO)

indometacin (EXP)

inulin (ISO)

isotretinoin (ISO)

ivermectin (ISO)

L-methionine (ISO)

leflunomide (EXP)

lithium atom (EXP)

lithium hydride (EXP)

metformin (EXP)

methapyrilene (EXP)

methidathion (ISO)

methimazole (EXP)

methotrexate (ISO)

mono(2-ethylhexyl) phthalate (ISO)

monosodium L-glutamate (ISO)

morphine (EXP)

Muraglitazar (EXP,ISO)

N-methyl-N-nitrosourea (ISO)

nafenopin (EXP)

nefazodone (EXP)

nimesulide (EXP)

nitric oxide (ISO)

oleic acid (ISO)

ozone (ISO)

paclitaxel (EXP)

paracetamol (EXP,ISO)

perfluorodecanoic acid (EXP)

perfluorododecanoic acid (EXP)

perfluorohexanesulfonic acid (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (EXP,ISO)

perfluorooctanoic acid (EXP,ISO)

phenformin (EXP)

phenobarbital (EXP)

piperonyl butoxide (EXP)

pirinixic acid (EXP,ISO)

potassium chromate (ISO)

pravastatin (EXP,ISO)

pregnenolone 16alpha-carbonitrile (EXP)

progesterone (EXP)

quercetin (EXP)

rac-1,2-dichloropropane (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

rotenone (EXP)

S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO)

sodium arsenite (EXP,ISO)

sulfadimethoxine (EXP)

sulforaphane (EXP,ISO)

sunitinib (ISO)

tacrolimus hydrate (ISO)

tert-butyl ethyl ether (EXP)

tert-butyl hydroperoxide (ISO)

Tesaglitazar (EXP,ISO)

testosterone (ISO)

tetrachloroethene (ISO)

tetrachloromethane (EXP)

thapsigargin (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

tremolite asbestos (ISO)

trichloroethene (EXP,ISO)

triptonide (ISO)

troglitazone (EXP,ISO)

tunicamycin (ISO)

urethane (ISO)

valdecoxib (EXP)

valproic acid (ISO)

vorinostat (ISO)

zaragozic acid A (EXP,ISO)

zearalenone (ISO)

zinc atom (EXP)

zinc(0) (EXP)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

fatty acid beta-oxidation (IEA)

Cellular Component

mitochondrion (IBA,IDA,IEA)

peroxisome (IEA)

Molecular Function

delta(3,5)-delta(2,4)-dienoyl-CoA isomerase activity (IBA,IEA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Delta3,5-delta2,4-dienoyl-CoA isomerase from rat liver. Molecular characterization.	Filppula SA, etal., J Biol Chem. 1998 Jan 2;273(1):349-55.
2.	Isolation and characterization of rat and human cDNAs encoding a novel putative peroxisomal enoyl-CoA hydratase.	FitzPatrick DR, etal., Genomics 1995 Jun 10;27(3):457-66.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
6.	Enoyl coenzyme A hydratase 1 combats obesity and related metabolic disorders by promoting adipose tissue browning.	Mao X, etal., Am J Physiol Endocrinol Metab. 2020 Mar 1;318(3):E318-E329. doi: 10.1152/ajpendo.00424.2019. Epub 2020 Jan 21.
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	GOA pipeline	RGD automated data pipeline
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
12.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:9739087	PMID:14651853	PMID:15489334	PMID:18614015	PMID:19946888	PMID:20178365	PMID:20458337	PMID:23376485	PMID:26316108

Genomics

Comparative Map Data

Ech1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	93,241,076 - 93,248,314 (+)	NCBI		GRCr8
mRatBN7.2	1	84,114,494 - 84,120,788 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	84,112,751 - 84,120,795 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	89,524,636 - 89,530,833 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	97,983,698 - 97,989,944 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	91,280,494 - 91,286,691 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	87,009,798 - 87,015,996 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	87,009,730 - 87,016,005 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	88,190,416 - 88,196,614 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	83,932,720 - 83,938,918 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	84,010,830 - 84,017,029 (+)	NCBI
Celera	1	78,504,909 - 78,511,107 (+)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

ECH1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	38,815,422 - 38,831,794 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	38,815,422 - 38,831,841 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	39,306,062 - 39,322,434 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	43,997,902 - 44,014,337 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	43,997,909 - 44,014,278	NCBI
Celera	19	36,108,519 - 36,124,956 (-)	NCBI		Celera
Cytogenetic Map	19	q13.2	NCBI
HuRef	19	35,752,797 - 35,769,242 (-)	NCBI		HuRef
CHM1_1	19	39,306,533 - 39,322,968 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	41,619,465 - 41,635,846 (-)	NCBI		T2T-CHM13v2.0

Ech1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	28,524,763 - 28,531,664 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	28,524,642 - 28,531,672 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	28,825,338 - 28,832,239 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	28,825,217 - 28,832,247 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	29,610,357 - 29,617,258 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	28,534,098 - 28,540,999 (+)	NCBI		MGSCv36	mm8
Celera	7	23,386,212 - 23,393,113 (+)	NCBI		Celera
Cytogenetic Map	7	B1	NCBI
cM Map	7	16.94	NCBI

Ech1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955468	686,171 - 692,737 (+)	NCBI	ChiLan1.0	ChiLan1.0

LOC100980944
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	45,106,270 - 45,122,592 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	46,976,768 - 46,993,103 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	35,909,348 - 35,925,686 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	44,479,555 - 44,489,355 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	44,479,561 - 44,489,355 (-)	Ensembl	panpan1.1		panPan2

ECH1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	114,281,754 - 114,291,211 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1

Ech1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	13,352,637 - 13,357,795 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936661	1,780,706 - 1,785,864 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ECH1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	47,627,062 - 47,639,291 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	47,627,056 - 47,638,961 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	43,166,641 - 43,178,371 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3
Pig Cytomap	6	q21	NCBI

ECH1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	33,439,490 - 33,449,349 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	33,439,682 - 33,449,272 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666073	11,451,944 - 11,461,942 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ech1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624794	12,195,385 - 12,203,606 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624794	12,196,402 - 12,203,674 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ech1
33 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	123
Count of miRNA genes:	104
Interacting mature miRNAs:	109
Transcripts:	ENSRNOT00000027537
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	53863041	90532583	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
1300121	Hrtrt1	Heart rate QTL 1	3.7		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	65789093	115540829	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	66023617	118608521	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	72197680	90508767	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	77494165	122494165	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	77857876	122857876	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	77876254	106047988	Rat
61344	Bp29	Blood pressure QTL 29	7.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	78350581	123350581	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	78430536	123430536	Rat
61433	Cia2	Collagen induced arthritis QTL 2	5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	78430754	91209302	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	78479925	123479925	Rat
4889494	Scort2	Serum corticosterone level QTL 2	4.2		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	80592172	125592172	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
2313083	Bmd74	Bone mineral density QTL 74	4	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	82174743	118944897	Rat
738022	Anxrr13	Anxiety related response QTL 13	4.6	0.00039	locomotor behavior trait (VT:0001392)	number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514)	1	83547917	128547917	Rat

Markers in Region

D1Bda9

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	84,120,602 - 84,120,731 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	87,015,811 - 87,015,939	NCBI	Rnor6.0
Rnor_5.0	1	88,196,429 - 88,196,557	UniSTS	Rnor5.0
RGSC_v3.4	1	83,938,733 - 83,938,861	UniSTS	RGSC3.4
Celera	1	78,510,922 - 78,511,050	UniSTS
Cytogenetic Map	1	q21	UniSTS

AI102822

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	84,120,336 - 84,120,682 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	87,015,545 - 87,015,890	NCBI	Rnor6.0
Rnor_5.0	1	88,196,163 - 88,196,508	UniSTS	Rnor5.0
RGSC_v3.4	1	83,938,467 - 83,938,812	UniSTS	RGSC3.4
Celera	1	78,510,656 - 78,511,001	UniSTS
RH 3.4 Map	1	837.4	UniSTS
Cytogenetic Map	1	q21	UniSTS

RH124256

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	84,120,402 - 84,120,638 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	87,015,611 - 87,015,846	NCBI	Rnor6.0
Rnor_5.0	1	88,196,229 - 88,196,464	UniSTS	Rnor5.0
RGSC_v3.4	1	83,938,533 - 83,938,768	UniSTS	RGSC3.4
Celera	1	78,510,722 - 78,510,957	UniSTS
Cytogenetic Map	1	q21	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022594	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272779	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC060565	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC062226	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214121	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230435	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U08976	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000027537 ⟹ ENSRNOP00000027537

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	84,115,082 - 84,120,795 (+)	Ensembl
Rnor_6.0 Ensembl	1	87,009,730 - 87,016,005 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000096349 ⟹ ENSRNOP00000085027

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	84,112,751 - 84,120,794 (+)	Ensembl

RefSeq Acc Id:

NM_022594 ⟹ NP_072116

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	93,242,106 - 93,248,304 (+)	NCBI
mRatBN7.2	1	84,114,590 - 84,120,788 (+)	NCBI
Rnor_6.0	1	87,009,798 - 87,015,996 (+)	NCBI
Rnor_5.0	1	88,190,416 - 88,196,614 (+)	NCBI
RGSC_v3.4	1	83,932,720 - 83,938,918 (+)	RGD
Celera	1	78,504,909 - 78,511,107 (+)	RGD

Sequence:

show sequence

AGCTCCAGAGATGGCTACCGCGATGACAGTTTCCAGCAAACTCCTCGGCCTGCTGATGCAGCAG
CTGAGAGGTACCCGCCAGCTGTACTTCAACGTCAGCCTTCGATCTCTGAGCTCCTCTGCACAAG
AGGCGTCCAAAAGAATCCCTGAGGAAGTCTCAGACCACAACTACGAGTCTATTCAAGTAACATC
TGCCCAGAAGCATGTTCTGCATGTACAACTAAACCGGCCGGAGAAGAGGAATGCCATGAACAGG
GCTTTCTGGAGGGAGTTGGTGGAATGCTTCCAAAAGATATCTAAAGACTCCGACTGTCGGGCTG
TTGTGGTCTCTGGTGCAGGAAAGATGTTCACTTCAGGTATTGACCTCATGGACATGGCATCAGA
CATCCTGCAGCCCCCAGGAGACGATGTGGCCCGCATAGCCTGGTACCTCCGAGACCTCATCAGC
CGATACCAAAAGACTTTCACTGTCATTGAGAAGTGCCCCAAGCCGGTGATCACCGCAATTCACG
GAGGCTGCATTGGTGGAGGCGTGGATCTTATTTCTGCCTGTGACATTCGCTACTGCACTCAGGA
TGCTTTCTTCCAAGTCAAGGAGGTGGATGTGGGCCTGGCTGCTGATGTAGGAACGCTGCAGCGA
CTGCCCAAGGTCATTGGGAACCGGAGCCTGGTCAACGAGCTGACCTTCACCGCCCGCAAGATGA
TGGCTGACGAGGCCCTGGACAGTGGGCTGGTCAGCCGCGTGTTCCCAGATAAGGACGTCATGCT
GAATGCAGCCTTTGCCCTGGCGGCCGATATTTCCAGCAAGAGTCCTGTGGCTGTGCAGGGGTCA
AAAATCAATTTAATCTACTCCCGAGACCATTCTGTGGACGAGAGCCTTGACTATATGGCCACTT
GGAACATGAGCATGCTGCAGACCCAGGACATCATCAAGTCAGTCCAGGCAGCCATGGAGAAGAA
GGACTCAAAAAGCATCACCTTCTCCAAGCTCTGAGTGCCTTCCTGACCCTGGTCCCCTCAGTGC
CTCCTCCCGGTGTATAACTTTATGACTTAGTTCTTCAGTTCCCGGGGCCTTATCTCCACTGTGA
ACAATAAAG

hide sequence

RefSeq Acc Id:

XM_063272779 ⟹ XP_063128849

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	93,241,076 - 93,248,314 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_072116	(Get FASTA)	NCBI Sequence Viewer
	XP_063128849	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA82008	(Get FASTA)	NCBI Sequence Viewer
	AAH62226	(Get FASTA)	NCBI Sequence Viewer
	EDM07870	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000027537.4
	ENSRNOP00000085027
	ENSRNOP00000085027.1
	ENSRNOP00055047435
GenBank Protein	Q62651	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_072116 ⟸ NM_022594
- Peptide Label:	precursor
- UniProtKB:	Q62651 (UniProtKB/Swiss-Prot), A6J9L4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MATAMTVSSKLLGLLMQQLRGTRQLYFNVSLRSLSSSAQEASKRIPEEVSDHNYESIQVTSAQK HVLHVQLNRPEKRNAMNRAFWRELVECFQKISKDSDCRAVVVSGAGKMFTSGIDLMDMASDILQ PPGDDVARIAWYLRDLISRYQKTFTVIEKCPKPVITAIHGGCIGGGVDLISACDIRYCTQDAFF QVKEVDVGLAADVGTLQRLPKVIGNRSLVNELTFTARKMMADEALDSGLVSRVFPDKDVMLNAA FALAADISSKSPVAVQGSKINLIYSRDHSVDESLDYMATWNMSMLQTQDIIKSVQAAMEKKDSK SITFSKL hide sequence

RefSeq Acc Id:

ENSRNOP00000027537 ⟸ ENSRNOT00000027537

RefSeq Acc Id:

ENSRNOP00000085027 ⟸ ENSRNOT00000096349

RefSeq Acc Id:	XP_063128849 ⟸ XM_063272779
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q62651-F1-model_v2	AlphaFold	Q62651	1-327	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689888

Promoter ID:

EPDNEW_R411

Type:

multiple initiation site

Name:

Ech1_1

Description:

enoyl-CoA hydratase 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	87,009,796 - 87,009,856	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:69353	AgrOrtholog
BioCyc Gene	G2FUF-60213	BioCyc
BioCyc Pathway	PWY-6837 [fatty acid beta-oxidation V (unsaturated, odd number, di-isomerase-dependent)]	BioCyc
BioCyc Pathway Image	PWY-6837	BioCyc
Ensembl Genes	ENSRNOG00000020308	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055033295	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000027537.7	UniProtKB/TrEMBL
	ENSRNOT00000096349	ENTREZGENE
	ENSRNOT00000096349.1	UniProtKB/Swiss-Prot
	ENSRNOT00055057543	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.12.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:6890529	IMAGE-MGC_LOAD
	IMAGE:6921895	IMAGE-MGC_LOAD
InterPro	ClpP/crotonase-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ech1-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Enoyl-CoA_hyd/isom_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Enoyl-CoA_hydra/iso	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Enoyl-CoA_hydra_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:64526	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72820	IMAGE-MGC_LOAD
	MGC:72821	IMAGE-MGC_LOAD
NCBI Gene	64526	ENTREZGENE
PANTHER	DELTA(3,5)-DELTA(2,4)-DIENOYL-COA ISOMERASE, MITOCHONDRIAL	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR43149	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	ECH_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Ech1	PhenoGen
PROSITE	ENOYL_COA_HYDRATASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000020308	RatGTEx
	ENSRNOG00055033295	RatGTEx
Superfamily-SCOP	SSF52096	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC216608
UniProt	A0A8L2QF26_RAT	UniProtKB/TrEMBL
	A6J9L4	ENTREZGENE, UniProtKB/TrEMBL
	ECH1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-07-06	Ech1	enoyl-CoA hydratase 1	Ech1	enoyl CoA hydratase 1, peroxisomal	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-08-02	Ech1	enoyl CoA hydratase 1, peroxisomal	Ech1	enoyl coenzyme A hydratase 1, peroxisomal	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Ech1	enoyl coenzyme A hydratase 1, peroxisomal		enoyl coenzyme A hydratase 1	Name updated	1299863	APPROVED
2002-06-10	Ech1	enoyl coenzyme A hydratase 1			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	mRNA expressed in liver	68827
gene_regulation	mRNA expression upregulated by peroxisome proliferator	68827

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

BioCyc Pathways