Mxd3 (Max dimerization protein 3)

Gene: Mxd3 (Max dimerization protein 3) Rattus norvegicus

Analyze

Symbol:

Mxd3

Name:

Max dimerization protein 3

RGD ID:

628624

Description:

Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to contribute to DNA-binding transcription repressor activity, RNA polymerase II-specific and RNA polymerase II transcription regulatory region sequence-specific DNA binding activity. Predicted to be involved in negative regulation of transcription by RNA polymerase II. Predicted to act upstream of or within negative regulation of DNA-templated transcription. Predicted to be part of RNA polymerase II transcription regulator complex. Orthologous to human MXD3 (MAX dimerization protein 3); INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Mad3; max dimerizer 3; max-associated protein 3; max-interacting transcriptional repressor MAD3; Myx

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MXD3 (MAX dimerization protein 3)	RGD	RGD
Mus musculus (house mouse):	Mxd3 (Max dimerization protein 3)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Mxd3 (MAX dimerization protein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MXD3 (MAX dimerization protein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MXD3 (MAX dimerization protein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mxd3 (MAX dimerization protein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MXD3 (MAX dimerization protein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MXD3 (MAX dimerization protein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mxd3 (MAX dimerization protein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	MXD3 (MAX dimerization protein 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Mxd3 (Max dimerization protein 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mxd3 (MAX dimerization protein 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mdl-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mxd3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	9,306,552 - 9,310,278 (+)	NCBI		GRCr8
mRatBN7.2	17	9,301,430 - 9,305,156 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	9,301,399 - 9,305,157 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	9,317,852 - 9,321,578 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	10,846,971 - 10,850,712 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	9,314,244 - 9,317,970 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	9,830,326 - 9,834,052 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	9,830,332 - 9,839,452 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	11,940,006 - 11,943,732 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	15,346,165 - 15,349,891 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	15,346,164 - 15,349,891 (+)	NCBI
Celera	17	9,379,809 - 9,383,526 (+)	NCBI		Celera
Cytogenetic Map	17	p14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Chromosome 5, Trisomy 5q (ISO)

Ehlers-Danlos syndrome dermatosparaxis type (ISO)

Ehlers-Danlos syndrome spondylodysplastic type 2 (ISO)

genetic disease (ISO)

Marfanoid Mental Retardation Syndrome, Autosomal (ISO)

Sotos syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP,ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-diaminodiphenylmethane (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrolein (ISO)

acrylamide (EXP,ISO)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bisphenol A (EXP)

butanal (ISO)

calcitriol (ISO)

carbon nanotube (ISO)

clobetasol (ISO)

clofibrate (ISO)

cobalt dichloride (EXP)

curcumin (ISO)

cycloheximide (ISO)

cyclosporin A (ISO)

cytarabine (ISO)

diallyl trisulfide (ISO)

diazinon (ISO)

dibutyl phthalate (EXP,ISO)

dicrotophos (ISO)

dimethylarsinic acid (ISO)

furan (EXP)

lidocaine (EXP)

methylarsonic acid (ISO)

N-Nitrosopyrrolidine (ISO)

naphthalene (ISO)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (ISO)

PCB138 (ISO)

perfluorooctanoic acid (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

propanal (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

styrene (ISO)

sunitinib (ISO)

testosterone (ISO)

titanium dioxide (ISO)

topotecan (EXP)

trimellitic anhydride (ISO)

troglitazone (ISO)

trovafloxacin (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

negative regulation of DNA-templated transcription (ISO)

negative regulation of transcription by RNA polymerase II (IEA,ISO)

regulation of transcription by RNA polymerase II (IBA)

Cellular Component

RNA polymerase II transcription regulator complex (IEA,ISO)

Molecular Function

DNA binding (ISO)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

DNA-binding transcription repressor activity, RNA polymerase II-specific (IEA,ISO)

protein binding (ISO)

protein dimerization activity (IEA)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IEA)

RNA polymerase II transcription regulatory region sequence-specific DNA binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Information Derived from GenBank Report	RGD, Sept. 2003

Additional References at PubMed

PMID:8521822

Genomics

Comparative Map Data

Mxd3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	9,306,552 - 9,310,278 (+)	NCBI		GRCr8
mRatBN7.2	17	9,301,430 - 9,305,156 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	9,301,399 - 9,305,157 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	9,317,852 - 9,321,578 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	10,846,971 - 10,850,712 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	9,314,244 - 9,317,970 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	9,830,326 - 9,834,052 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	9,830,332 - 9,839,452 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	11,940,006 - 11,943,732 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	15,346,165 - 15,349,891 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	15,346,164 - 15,349,891 (+)	NCBI
Celera	17	9,379,809 - 9,383,526 (+)	NCBI		Celera
Cytogenetic Map	17	p14	NCBI

MXD3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	177,305,499 - 177,312,752 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	177,301,461 - 177,312,757 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	176,732,500 - 176,739,753 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	176,666,817 - 176,671,487 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	176,666,817 - 176,671,487	NCBI
Celera	5	171,762,037 - 171,768,860 (+)	NCBI		Celera
Cytogenetic Map	5	q35.3	NCBI
HuRef	5	171,653,234 - 171,660,025 (-)	NCBI		HuRef
CHM1_1	5	176,165,543 - 176,172,334 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	177,848,733 - 177,855,986 (-)	NCBI		T2T-CHM13v2.0

Mxd3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	55,472,983 - 55,477,937 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	55,472,981 - 55,477,636 (-)	Ensembl		GRCm39 Ensembl
GRCm38	13	55,325,170 - 55,329,900 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	55,325,168 - 55,329,823 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	55,426,529 - 55,431,091 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	55,335,101 - 55,339,355 (-)	NCBI		MGSCv36	mm8
Celera	13	56,380,748 - 56,385,369 (-)	NCBI		Celera
Cytogenetic Map	13	B1	NCBI
cM Map	13	29.8	NCBI

Mxd3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955408	29,555,406 - 29,559,451 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955408	29,555,028 - 29,560,589 (-)	NCBI	ChiLan1.0	ChiLan1.0

MXD3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	172,391,727 - 172,402,288 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	170,531,264 - 170,541,827 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	172,609,158 - 172,615,345 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	179,673,221 - 179,679,289 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	179,673,135 - 179,677,842 (-)	Ensembl	panpan1.1		panPan2

MXD3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	36,044,432 - 36,054,828 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	36,046,982 - 36,050,899 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	36,010,966 - 36,018,548 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	36,409,867 - 36,417,448 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	36,413,135 - 36,417,052 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	36,234,968 - 36,242,548 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	36,421,160 - 36,428,740 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	36,930,709 - 36,938,291 (+)	NCBI		UU_Cfam_GSD_1.0

Mxd3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	122,559,791 - 122,564,441 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936597	1,584,783 - 1,588,931 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936597	1,584,047 - 1,588,930 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MXD3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	80,637,323 - 80,641,950 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	80,636,778 - 80,641,346 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	82,227,494 - 82,232,062 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MXD3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	79,317,049 - 79,323,811 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	79,317,436 - 79,322,431 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666075	10,505,494 - 10,511,490 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mxd3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624733	12,769,245 - 12,774,778 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624733	12,769,031 - 12,777,613 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Mxd3
7 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	203
Count of miRNA genes:	143
Interacting mature miRNAs:	158
Transcripts:	ENSRNOT00000021946
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
9590316	Scort21	Serum corticosterone level QTL 21	4.75	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	1	22871563	Rat
10401807	Kidm52	Kidney mass QTL 52			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	17	1	31701463	Rat
70184	BpQTLcluster14	Blood pressure QTL cluster 14	3.38		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	1	31990913	Rat
631207	Niddm41	Non-insulin dependent diabetes mellitus QTL 41			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	17	1	37830672	Rat
1354658	Spl8	Serum phospholipid level QTL 8	3.8		blood VLDL phospholipid amount (VT:0010507)	blood very low density lipoprotein phospholipid level (CMO:0001571)	17	1	60781592	Rat
1354581	Bp247	Blood pressure QTL 247	4.5		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	17	1	69599340	Rat
1354662	Rf49	Renal function QTL 49	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	17	1	69599340	Rat
1641902	Colcr7	Colorectal carcinoma resistance QTL 7	3.35	0.0044	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	17	2115149	21881669	Rat
1300123	Bp194	Blood pressure QTL 194	2.82		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	2115149	34551001	Rat
631499	Stl1	Serum triglyceride level QTL 1	3.6		blood triglyceride amount (VT:0002644)	blood triglyceride level (CMO:0000118)	17	3271398	27389946	Rat
2324619	Coatc4	Coat color QTL 4		0.001	coat/hair pigmentation trait (VT:0010463)	pigmented coat/hair area to total coat/hair area ratio (CMO:0001810)	17	4299130	21293263	Rat
2324619	Coatc4	Coat color QTL 4		0.001	coat/hair pigmentation trait (VT:0010463)	pigmented dorsal coat/hair area to total dorsal coat/hair area ratio (CMO:0001811)	17	4299130	21293263	Rat
1354613	Kidm14	Kidney mass QTL 14	6.2		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	17	4299130	35837242	Rat
1354596	Bw32	Body weight QTL 32	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	17	4299130	60781592	Rat
1354630	Cm34	Cardiac mass QTL 34	8.7		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	17	4299130	69599340	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	4299130	69599340	Rat
1354651	Lmblg2	Limb length QTL 2	6		tibia length (VT:0004357)	tibia length (CMO:0000450)	17	4299130	69599340	Rat
2293648	Bmd31	Bone mineral density QTL 31	4.5	0.0001	femur size trait (VT:1000369)	femoral neck cortical cross-sectional area (CMO:0001702)	17	4354487	27028127	Rat
2293664	Bmd28	Bone mineral density QTL 28	5.1	0.0001	femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	17	4354487	27028127	Rat
2303627	Vencon8	Ventilatory control QTL 8		0.001	respiration trait (VT:0001943)	tidal volume (CMO:0000222)	17	4528038	49528038	Rat
10054088	Scort28	Serum corticosterone level QTL 28	2.04	0.0102	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	4528038	49528038	Rat
1581553	Pur14	Proteinuria QTL 14	5.3	0.0001	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	17	7979968	16317111	Rat
2303561	Bw91	Body weight QTL 91	2		body mass (VT:0001259)	body weight (CMO:0000012)	17	8868462	53868462	Rat
1582199	Insul5	Insulin level QTL 5	3.4	0.0119	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	17	9201365	23653323	Rat
1582208	Kidm32	Kidney mass QTL 32	3.9	0.0018	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	17	9201365	23653323	Rat
1582224	Epfw4	Epididymal fat weight QTL 4	3.5	0.0058	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	17	9201365	23653323	Rat
1582225	Bw67	Body weight QTL 67	6.2	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
1582226	Bw64	Body weight QTL 64	4.2	0.0017	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
1582241	Bw70	Body weight QTL 70	4.6	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
1582245	Bw73	Body weight QTL 73	4.6	0.0004	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
1582258	Bw76	Body weight QTL 76	4.6	0.0005	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat

Markers in Region

D17Got12

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	9,301,937 - 9,302,095 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	9,830,834 - 9,830,991	NCBI	Rnor6.0
Rnor_5.0	17	11,940,514 - 11,940,671	UniSTS	Rnor5.0
RGSC_v3.4	17	15,346,672 - 15,346,830	RGD	RGSC3.4
RGSC_v3.4	17	15,346,673 - 15,346,830	UniSTS	RGSC3.4
RGSC_v3.1	17	15,346,673 - 15,346,830	RGD
Celera	17	9,380,317 - 9,380,453	UniSTS
RH 3.4 Map	17	84.3	UniSTS
RH 3.4 Map	17	84.3	RGD
Cytogenetic Map	17	p14	UniSTS

RH128304

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	9,305,350 - 9,305,534 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	9,834,247 - 9,834,430	NCBI	Rnor6.0
Rnor_5.0	17	11,943,927 - 11,944,110	UniSTS	Rnor5.0
RGSC_v3.4	17	15,350,086 - 15,350,269	UniSTS	RGSC3.4
Celera	17	9,383,721 - 9,383,904	UniSTS
RH 3.4 Map	17	80.0	UniSTS
Cytogenetic Map	17	p14	UniSTS

RH131590

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	9,304,932 - 9,305,132 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	9,833,829 - 9,834,028	NCBI	Rnor6.0
Rnor_5.0	17	11,943,509 - 11,943,708	UniSTS	Rnor5.0
RGSC_v3.4	17	15,349,668 - 15,349,867	UniSTS	RGSC3.4
Celera	17	9,383,303 - 9,383,502	UniSTS
RH 3.4 Map	17	77.9	UniSTS
Cytogenetic Map	17	p14	UniSTS

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_145773	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC095305	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474032	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234290	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U45986	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000076436 ⟹ ENSRNOP00000068446

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	9,308,525 - 9,310,553 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000104750 ⟹ ENSRNOP00000094537

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	9,301,399 - 9,305,157 (+)	Ensembl

RefSeq Acc Id:

NM_145773 ⟹ NP_665716

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	9,306,552 - 9,310,278 (+)	NCBI
mRatBN7.2	17	9,301,430 - 9,305,156 (+)	NCBI
Rnor_6.0	17	9,830,326 - 9,834,052 (+)	NCBI
Rnor_5.0	17	11,940,006 - 11,943,732 (+)	NCBI
RGSC_v3.4	17	15,346,165 - 15,349,891 (+)	RGD
Celera	17	9,379,809 - 9,383,526 (+)	RGD

Sequence:

show sequence

AGGCATTGAAACAAAAGTGGTAACGCGGCTGCCAGGGCCAGCATCCCTATCCCGCTCGCCGTCG
CTGTCGCCGACATGGAACCCGTGGCTAGCAACATCCAGGTCCTGCTGCAGGCAGCGGAGTTCCT
GGAGAGGCGCGAGAGAGAGGCGGAGCACGGTTATGCGTCCCTGTGTCCACACCACAGTCCCGGG
ACCGTATGCAGGAGGAGGAAGGCACCCCTGCAAGCTCCTGGCGCGCTCAACAGTGGGCGGCATG
TGCACAATGAGCTGGAGAAACGGAGGAGAGCCCAGCTGAAGCGGTGCTTAGAGCAACTGAGGCA
GCAGATGCCCTTGGGAGTTGACCATACCCGATATACTACACTGAGCCTGCTGCGCGGAGCCAGG
ATGCACATCCAGAAGCTGGAGGAGCAGGAGCAGCAGGCCCAGCGGCTCAAGGAGAAGCTTCGGA
GCAGACAGCAGAGCCTGCAGCAGCAGTTGGAGCAGCTCCAGGGGCTGCTGGGAGTGAGAGAGCG
GGACCGGCTGAGAGCTGACAGCCTCGATTCTTCAGGCCTGTCCTCTGAGCGCTTTGACTCGGAC
CAAGAGGATCTGGAGGTGGATGTGGAAAGCCTGGTGTTTGGGACTGAGACGGAGCTCCTACAGA
GCTTCAGCGCTGGGCAGGAGCACAGCTACTCACACAGCACTGGCACCTGGCTATGATGCCCGCC
GCCGGAGTGGCCTGTACTCTCTCTGGACTGAACCCGCCAGTCAGTGGCTCACAGCCACGTGTCG
AAGTGACAATAAAGCCATCACCGTGTGGGAGCAGATTCTGGACTCTGCTGCACAGCTTGAGCCT
GGGCTACCCTCCCCACCCCCAGGGGATTTTATGTAGCGCTTGGCTCTGCTCTGCTGCTCCCACA
GGGACCAGAGGCCTGTAAACTTCTTGTTCCTGCAAAGCCCCAGCCTCTGCCCATATATACCGCA
CAGTATTTTCATTAAAATCCTCTTTCATA

hide sequence

Protein Sequences


Protein RefSeqs	NP_665716	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA91185	(Get FASTA)	NCBI Sequence Viewer
	EDL93998	(Get FASTA)	NCBI Sequence Viewer
	EDL93999	(Get FASTA)	NCBI Sequence Viewer
	EDL94000	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000094537
	ENSRNOP00000094537.1
GenBank Protein	Q62912	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_665716 ⟸ NM_145773

- UniProtKB:

Q62912 (UniProtKB/Swiss-Prot), G3V831 (UniProtKB/TrEMBL), A6KAU0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEPVASNIQVLLQAAEFLERREREAEHGYASLCPHHSPGTVCRRRKAPLQAPGALNSGRHVHNE
LEKRRRAQLKRCLEQLRQQMPLGVDHTRYTTLSLLRGARMHIQKLEEQEQQAQRLKEKLRSRQQ
SLQQQLEQLQGLLGVRERDRLRADSLDSSGLSSERFDSDQEDLEVDVESLVFGTETELLQSFSA
GQEHSYSHSTGTWL

hide sequence

RefSeq Acc Id:

ENSRNOP00000094537 ⟸ ENSRNOT00000104750

RefSeq Acc Id:

ENSRNOP00000068446 ⟸ ENSRNOT00000076436

Protein Domains

bHLH

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q62912-F1-model_v2	AlphaFold	Q62912	1-206	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700310

Promoter ID:

EPDNEW_R10833

Type:

initiation region

Name:

Rab24_3

Description:

RAB24, member RAS oncogene family

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R10834 EPDNEW_R10836

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	17	9,830,335 - 9,830,395	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:628624	AgrOrtholog
BioCyc Gene	G2FUF-10197	BioCyc
Ensembl Genes	ENSRNOG00000016539	Ensembl
	ENSRNOG00000070523	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000104750	ENTREZGENE
	ENSRNOT00000104750.1	UniProtKB/TrEMBL
Gene3D-CATH	4.10.280.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	bHLH_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HLH_DNA-bd_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:252915	UniProtKB/Swiss-Prot
NCBI Gene	252915	ENTREZGENE
PANTHER	MAX DIMERIZATION PROTEIN 3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	MAX DIMERIZATION, MAD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	HLH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Mxd3	PhenoGen
PROSITE	BHLH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000016539	RatGTEx
	ENSRNOG00000070523	RatGTEx
SMART	HLH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF47459	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6KAU0	ENTREZGENE, UniProtKB/TrEMBL
	A6KAU1_RAT	UniProtKB/TrEMBL
	A6KAU2_RAT	UniProtKB/TrEMBL
	G3V831	ENTREZGENE, UniProtKB/TrEMBL
	MAD3_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Mxd3	Max dimerization protein 3	Mad3		Symbol updated	1299863	APPROVED
2003-02-27	Mad3	Max dimerization protein 3			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar