As3mt (arsenite methyltransferase)

Gene: As3mt (arsenite methyltransferase) Rattus norvegicus

Analyze

Symbol:

As3mt

Name:

arsenite methyltransferase

RGD ID:

621325

Description:

Enables arsenite methyltransferase activity and methylarsonite methyltransferase activity. Involved in arsonoacetate metabolic process and toxin metabolic process. Acts upstream of or within response to arsenic-containing substance. Located in cytosol. Orthologous to human AS3MT (arsenite methyltransferase); PARTICIPATES IN homocysteine metabolic pathway; methionine cycle/metabolic pathway; INTERACTS WITH 1,4-dithiothreitol; 17beta-estradiol; 17beta-estradiol 3-benzoate.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

arsenic (+3 oxidation state) methyltransferase; Cyt19; methylarsonite methyltransferase; methyltransferase Cyt19; S-adenosyl-L-methionine:arsenic(III) methyltransferase; S-adenosylmethionine:arsenic (III) methyltransferase

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	AS3MT (arsenite methyltransferase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	As3mt (arsenite methyltransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	As3mt (arsenite methyltransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	AS3MT (arsenite methyltransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	AS3MT (arsenite methyltransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	As3mt (arsenite methyltransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	AS3MT (arsenite methyltransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	AS3MT (arsenite methyltransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	As3mt (arsenite methyltransferase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	AS3MT (arsenite methyltransferase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	as3mt (arsenite methyltransferase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	as3mt.2	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)

Candidate Gene For:

Rf1

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	255,536,879 - 255,569,245 (+)	NCBI		GRCr8
mRatBN7.2	1	245,595,939 - 245,628,921 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	245,596,108 - 245,627,872 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	253,723,062 - 253,755,177 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	260,417,406 - 260,449,225 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	253,065,883 - 253,097,650 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	266,482,787 - 266,514,570 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	266,482,858 - 266,514,569 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	273,913,062 - 273,945,394 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	252,029,638 - 252,061,352 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	252,292,792 - 252,324,506 (+)	NCBI
Celera	1	241,368,780 - 241,399,852 (+)	NCBI		Celera
Cytogenetic Map	1	q54	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Arsenic Poisoning (ISO)

attention deficit hyperactivity disorder (ISO)

Birth Weight (ISO)

Developmental Disabilities (ISO)

genetic disease (ISO)

Glandular and Epithelial Neoplasms (ISO)

Insulin Resistance (ISO)

Lung Neoplasms (ISO)

Micronuclei, Chromosome-Defective (ISO)

schizophrenia (ISO)

urinary bladder cancer (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

1,4-dithiothreitol (EXP,ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3-chloropropane-1,2-diol (EXP)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrylamide (ISO)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

arsane (EXP,ISO)

arsenic acid (EXP,ISO)

arsenic atom (EXP,ISO)

arsenite ion (EXP,ISO)

arsenite(3-) (ISO)

arsenous acid (EXP,ISO)

Aurothioglucose (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

buspirone (EXP)

butanal (ISO)

caffeine (ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

cobalt dichloride (EXP)

cocaine (EXP)

copper(II) sulfate (ISO)

cyanocob(III)alamin (ISO)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP)

dimethylarsinic acid (ISO)

dimethylarsinous acid (ISO)

dioxygen (ISO)

dorsomorphin (ISO)

elemental selenium (ISO)

ethanol (ISO)

flutamide (EXP)

folic acid (ISO)

furan (EXP)

glutathione (EXP,ISO)

hydrogen peroxide (ISO)

inulin (ISO)

irinotecan (EXP)

ivermectin (ISO)

L-1,4-dithiothreitol (EXP,ISO)

L-cysteine (ISO)

methylarsonic acid (ISO)

methylarsonite (ISO)

N-methyl-4-phenylpyridinium (ISO)

N-nitrosodiethylamine (ISO)

nickel atom (ISO)

panobinostat (ISO)

paracetamol (EXP,ISO)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

phosphatidylcholine (ISO)

pirinixic acid (ISO)

proanthocyanidin (ISO)

S-adenosyl-L-methioninate (ISO)

S-adenosyl-L-methionine (ISO)

SB 431542 (ISO)

selenium atom (ISO)

silicon dioxide (ISO)

sodium arsenate (EXP,ISO)

sodium arsenite (EXP,ISO)

sodium dichromate (EXP)

sunitinib (ISO)

tamoxifen (ISO)

tauroursodeoxycholic acid (EXP)

TCEP (EXP,ISO)

testosterone (EXP)

tetrachloromethane (ISO)

thioacetamide (EXP)

triazines (ISO)

trimethylarsine (EXP)

trimethylarsine oxide (EXP)

urethane (ISO)

valproic acid (ISO)

zearalenone (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

arsonoacetate metabolic process (IBA,IDA,IEA,ISO)

methylation (IEA,ISO)

response to arsenic-containing substance (IDA)

toxin metabolic process (IBA,IDA,IEA,ISO)

Cellular Component

cytosol (IBA,IDA,IEA)

Molecular Function

arsenite methyltransferase activity (IBA,IDA,IEA,ISO)

methylarsonite methyltransferase activity (IBA,IDA,IEA,ISO)

protein methyltransferase activity (TAS)

S-adenosylmethionine-dependent methyltransferase activity (TAS)

Molecular Pathway Annotations Click to see Annotation Detail View

homocysteine metabolic pathway (TAS)

methionine cycle/metabolic pathway (TAS)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	A novel S-adenosyl-L-methionine:arsenic(III) methyltransferase from rat liver cytosol.	Lin S, etal., J Biol Chem 2002 Mar 29;277(13):10795-803.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Elucidating the pathway for arsenic methylation.	Thomas DJ, etal., Toxicol Appl Pharmacol. 2004 Aug 1;198(3):319-26.

Additional References at PubMed

PMID:12477932	PMID:15606138	PMID:15808521	PMID:18614015	PMID:25997655	PMID:31505169

Genomics

Comparative Map Data

As3mt
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	255,536,879 - 255,569,245 (+)	NCBI		GRCr8
mRatBN7.2	1	245,595,939 - 245,628,921 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	245,596,108 - 245,627,872 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	253,723,062 - 253,755,177 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	260,417,406 - 260,449,225 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	253,065,883 - 253,097,650 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	266,482,787 - 266,514,570 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	266,482,858 - 266,514,569 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	273,913,062 - 273,945,394 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	252,029,638 - 252,061,352 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	252,292,792 - 252,324,506 (+)	NCBI
Celera	1	241,368,780 - 241,399,852 (+)	NCBI		Celera
Cytogenetic Map	1	q54	NCBI

AS3MT
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	102,869,470 - 102,901,899 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	102,869,470 - 102,901,899 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	10	104,629,227 - 104,661,656 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	104,619,200 - 104,651,646 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	10	104,619,262 - 104,651,643	NCBI
Celera	10	98,369,790 - 98,401,891 (+)	NCBI		Celera
Cytogenetic Map	10	q24.32	NCBI
HuRef	10	98,263,978 - 98,296,045 (+)	NCBI		HuRef
CHM1_1	10	104,912,421 - 104,944,505 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	103,755,254 - 103,787,669 (+)	NCBI		T2T-CHM13v2.0

As3mt
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	46,695,124 - 46,729,538 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	46,695,897 - 46,729,538 (+)	Ensembl		GRCm39 Ensembl
GRCm38	19	46,707,157 - 46,741,099 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	46,707,458 - 46,741,099 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	19	46,781,933 - 46,815,585 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	19	46,760,784 - 46,794,383 (+)	NCBI		MGSCv36	mm8
Celera	19	47,477,252 - 47,510,537 (+)	NCBI		Celera
Cytogenetic Map	19	C3	NCBI
cM Map	19	38.97	NCBI

As3mt
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955485	7,575,580 - 7,599,559 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955485	7,576,627 - 7,599,005 (-)	NCBI	ChiLan1.0	ChiLan1.0

AS3MT
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	114,754,257 - 114,788,919 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	114,759,814 - 114,794,242 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	99,470,026 - 99,502,829 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	102,933,503 - 102,964,692 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	102,933,671 - 102,964,692 (+)	Ensembl	panpan1.1		panPan2

AS3MT
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	28	15,334,141 - 15,350,749 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	28	15,503,892 - 15,522,525 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	28	15,806,818 - 15,825,455 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	28	15,788,533 - 15,990,025 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	28	15,350,453 - 15,369,076 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	28	15,389,645 - 15,408,259 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	28	15,522,659 - 15,541,286 (+)	NCBI		UU_Cfam_GSD_1.0

As3mt
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	31,447,159 - 31,466,576 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936600	3,051,129 - 3,069,690 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936600	3,050,946 - 3,069,786 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

AS3MT
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	113,847,859 - 113,869,507 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	113,844,107 - 113,867,880 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	123,816,442 - 123,853,246 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

AS3MT
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	95,911,465 - 95,939,554 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	95,912,086 - 95,939,375 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	57,023,327 - 57,052,295 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in As3mt
181 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	262
Count of miRNA genes:	186
Interacting mature miRNAs:	206
Transcripts:	ENSRNOT00000027223
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2316896	Gluco57	Glucose level QTL 57	7.2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	228985440	245907899	Rat
631669	Iddm9	Insulin dependent diabetes mellitus QTL 9	2.8	0.039	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	233190394	258625266	Rat
631690	Scl5	Serum cholesterol level QTL 5	2.1		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	236125214	260522016	Rat
731175	Uae20	Urinary albumin excretion QTL 20	3.5	0.0018	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	221264111	259647894	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	176426412	257976495	Rat
631836	Stl31	Serum triglyceride level QTL 31	4.64	0.00000487	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	1	237147813	260522016	Rat
631837	Niddm35	Non-insulin dependent diabetes mellitus QTL 35		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	238699859	259647894	Rat
631843	Bw116	Body weight QTL 116	4.1	0.016	abdominal adipose amount (VT:1000220)	abdominal fat pad weight (CMO:0000088)	1	224054293	260122809	Rat
7394701	Uae46	Urinary albumin excretion QTL 46	3.6	0.0056	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	201554356	246554356	Rat
1300108	Rf8	Renal function QTL 8	3.75		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	1	228581588	259647894	Rat
10053715	Scort24	Serum corticosterone level QTL 24	2.13	0.0088	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	221414816	260522016	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
1357399	Bw45	Body weight QTL 45	3.05		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	1	206329708	251329708	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	177227632	256448636	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	177227632	256448636	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
1358890	Bp259	Blood pressure QTL 259	3.06		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	210702053	260522016	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	191019702	246062233	Rat
1581544	Rf52	Renal function QTL 52		0.05	urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	1	232156370	259647894	Rat
1598821	Rf55	Renal function QTL 55	6.3		renal blood flow trait (VT:2000006)	ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239)	1	218748008	257976495	Rat
1600392	Bw123	Body weight QTL 123		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	223201027	260522016	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
61327	Eae7	Experimental allergic encephalomyelitis QTL 7	5.6		body mass (VT:0001259)	change in body weight (CMO:0002045)	1	216255568	260522016	Rat
61400	Niddm1	Non-insulin dependent diabetes mellitus QTL 1	11		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	218753689	245907899	Rat
70211	Niddm24	Non-insulin dependent diabetes mellitus QTL 24	3.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	214647894	259647894	Rat
631215	Stl8	Serum triglyceride level QTL 8	9.27	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	1	225126575	260522016	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
724533	Rf51	Renal function QTL 51	5.3	0.0002	kidney plasma flow trait (VT:0005524)	renal plasma flow (CMO:0001914)	1	218753816	256448513	Rat
724552	Glom2	Glomerulus QTL 2	3.3	0.0001	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	1	222363780	260522016	Rat
2302040	Pia35	Pristane induced arthritis QTL 35	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	216255568	260522016	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
631536	Lnnr2	Liver neoplastic nodule remodeling QTL 2	2.9	0.0005	liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705)	1	233948574	260522016	Rat
734769	Niddm58	Non-insulin dependent diabetes mellitus QTL 58			body mass (VT:0001259)	body weight (CMO:0000012)	1	224569538	260122809	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	179567751	260522016	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
2300175	Bmd40	Bone mineral density QTL 40	15.4	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	1	201554356	246554356	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
2293674	Bss39	Bone structure and strength QTL 39	7.1	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	1	201554356	246554356	Rat
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	199050459	259647894	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	195804352	257091168	Rat
734768	Niddm59	Non-insulin dependent diabetes mellitus QTL 59			body mass (VT:0001259)	body weight (CMO:0000012)	1	213843987	258843987	Rat
2293694	Bss38	Bone structure and strength QTL 38	7.05	0.0001	femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	1	201554356	246554356	Rat
1357404	Bw42	Body weight QTL 42	4.49	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	1	206329708	251329708	Rat
1549910	Bw54	Body weight QTL 54		0.05	body mass (VT:0001259)	body weight (CMO:0000012)	1	214647894	259647894	Rat
1600397	Edcs4	Endometrial carcinoma susceptibility QTL 4	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	1	206081677	251081677	Rat
734767	Niddm57	Non-insulin dependent diabetes mellitus QTL 57			body mass (VT:0001259)	body weight (CMO:0000012)	1	224054293	260122809	Rat
10059587	Bw173	Body weight QTL 173	3.23	0.025	body mass (VT:0001259)	body weight (CMO:0000012)	1	202069611	247069611	Rat
2293655	Bss36	Bone structure and strength QTL 36	10.66	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	201554356	246554356	Rat
724538	Kidm1	Kidney mass QTL 1	3.2		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	213707201	252085212	Rat

Markers in Region

RH135042

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	245,627,576 - 245,627,764 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	266,514,287 - 266,514,474	NCBI	Rnor6.0
Rnor_5.0	1	273,945,111 - 273,945,298	UniSTS	Rnor5.0
RGSC_v3.4	1	252,061,069 - 252,061,256	UniSTS	RGSC3.4
Celera	1	241,399,569 - 241,399,756	UniSTS
RH 3.4 Map	1	1628.9	UniSTS
Cytogenetic Map	1	q54	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	56	41	18	41	8	9	27	31	34	11	8
Low			1		1			2	47	4	7
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_080890	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017588707	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039082665	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039082696	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271150	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271221	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC099420	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC105488	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF393243	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC061533	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473986	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000027223 ⟹ ENSRNOP00000027223

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	245,596,108 - 245,627,872 (+)	Ensembl
Rnor_6.0 Ensembl	1	266,482,858 - 266,514,569 (+)	Ensembl

RefSeq Acc Id:

NM_080890 ⟹ NP_543166

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	255,537,511 - 255,569,245 (+)	NCBI
mRatBN7.2	1	245,596,116 - 245,627,860 (+)	NCBI
Rnor_6.0	1	266,482,858 - 266,514,570 (+)	NCBI
Rnor_5.0	1	273,913,062 - 273,945,394 (+)	NCBI
RGSC_v3.4	1	252,029,638 - 252,061,352 (+)	RGD
Celera	1	241,368,780 - 241,399,852 (+)	RGD

Sequence:

show sequence

AGAGGGAATCCCTGGTTCTGGAAGTGGAGATCGTGAGTCATGGCTGCTCCCCGAGACGCAGAGA
TCCACAAGGACGTTCAGAACTACTATGGGAATGTACTGAAGACATCTGCAGACCTCCAGACTAA
TGCTTGTGTCACCCCAGCCAAGGGGGTCCCTGAGTACATCCGGAAAAGTCTGCAGAATGTACAT
GAAGAAGTTATTTCCAGGTATTATGGCTGCGGTCTGGTGGTGCCTGAGCATCTGGAAAACTGCC
GGATTTTGGATCTGGGCAGTGGGAGTGGCAGAGATTGCTATGTGCTTAGCCAGCTGGTCGGCCA
GAAGGGACACATCACCGGGATAGACATGACTAAGGTCCAGGTGGAAGTGGCTAAGGCCTATCTT
GAGTACCACACGGAAAAGTTCGGTTTCCAGACACCCAATGTGACTTTTCTTCACGGCCAAATTG
AGATGTTGGCAGAGGCCGGGATCCAGAAGGAGAGCTATGATATCGTTATATCCAATTGTGTGAT
CAACCTTGTTCCCGACAAACAAAAAGTCCTTCGGGAGGTCTACCAAGTCCTGAAGTACGGCGGG
GAGCTCTATTTCAGTGACGTCTATGCTAGCCTTGAAGTGTCAGAAGACATCAAGTCACACAAGG
TTTTATGGGGGGAATGCCTGGGTGGCGCTCTGTACTGGAAGGACCTCGCCGTCATTGCCAAAAA
GATTGGGTTCTGCCCTCCACGTTTGGTCACTGCCAATATTATTACGGTTGGAAACAAGGAACTA
GAAAGGGTTCTTGGTGACTGTCGCTTCGTGTCTGCCACATTTCGCCTCTTCAAACTCCCTAAGA
CAGAGCCAGCCGGAAGATGCCAAGTTGTTTACAATGGAGGAATCATGGGGCACGAAAAGGAACT
AATTTTCGATGCAAATTTTACATTCAAGGAAGGTGAAGCTGTTGAAGTGGATGAGGAGACGGCA
GCCATCTTGAGGAACTCTCGGTTTGCTCACGATTTTCTCTTCACACCTGTTGAGGCCTCCCTGT
TGGCTCCCCAAACAAAGGTTATAATCAGAGATCCATTCAAGCTTGCAGAGGAATCTGACAAGAT
GAAGCCGAGATGTGCACCAGAAGGCACTGGAGGCTGCTGTGGCAAAAGGAAAAGCTGCTAGACC
TAGGGCCAGCGTAGAGCCCACCGAGCATGAGGGGGTGGCTAAAGGGCAGTCACAAAGTCTTCTG
AGCCTGCTCTTCACCAGAGCACAGACTATGGGAAGATGGCAAAGCCACTGCTAAGAAAAAGTGA
TTTTTAGAGGGTGTTAATTTAAGGTTCACAGCAAACTTTTTCTATTTCACTATTTCAGAGTTCT
GGCGCCACCTAGTGGTCAGAAGTAGAACTTGTACGTCTAAGGTTTACAAATATCTTCCTTCTGG
CCTACCACAGGACACCTCTGGGTTTTTCTCTGTGGTTATTCAGGAAGCACAGTACTTACTGAAT
TTATGCTGACTATGACAAAAGGTTGCCAACTCAAATTTGGTAGGAGTACTCTTTAGGTCGCTGT
CTTCAAACTTTTTTCCCTGTAAATGAATGAAAATGAAAACAAATGAAAAATAAATTTGACTTCA
TCCTGATAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039082665 ⟹ XP_038938593

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	255,536,879 - 255,563,832 (+)	NCBI
mRatBN7.2	1	245,595,952 - 245,628,921 (+)	NCBI

RefSeq Acc Id:

XM_039082696 ⟹ XP_038938624

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	255,536,879 - 255,569,243 (+)	NCBI
mRatBN7.2	1	245,595,939 - 245,627,860 (+)	NCBI

RefSeq Acc Id:

XM_063271150 ⟹ XP_063127220

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	255,536,879 - 255,568,672 (+)	NCBI

RefSeq Acc Id:

XM_063271221 ⟹ XP_063127291

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	255,536,879 - 255,555,231 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_543166	(Get FASTA)	NCBI Sequence Viewer
	XP_038938593	(Get FASTA)	NCBI Sequence Viewer
	XP_038938624	(Get FASTA)	NCBI Sequence Viewer
	XP_063127220	(Get FASTA)	NCBI Sequence Viewer
	XP_063127291	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH61533	(Get FASTA)	NCBI Sequence Viewer
	AAL61609	(Get FASTA)	NCBI Sequence Viewer
	EDL94361	(Get FASTA)	NCBI Sequence Viewer
	EDL94362	(Get FASTA)	NCBI Sequence Viewer
	EDL94363	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000027223
	ENSRNOP00000027223.5
	ENSRNOP00060042789
GenBank Protein	Q8VHT6	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_543166 ⟸ NM_080890

- UniProtKB:

Q8VHT6 (UniProtKB/Swiss-Prot), G3V8P2 (UniProtKB/TrEMBL), A6JHN7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAAPRDAEIHKDVQNYYGNVLKTSADLQTNACVTPAKGVPEYIRKSLQNVHEEVISRYYGCGLV
VPEHLENCRILDLGSGSGRDCYVLSQLVGQKGHITGIDMTKVQVEVAKAYLEYHTEKFGFQTPN
VTFLHGQIEMLAEAGIQKESYDIVISNCVINLVPDKQKVLREVYQVLKYGGELYFSDVYASLEV
SEDIKSHKVLWGECLGGALYWKDLAVIAKKIGFCPPRLVTANIITVGNKELERVLGDCRFVSAT
FRLFKLPKTEPAGRCQVVYNGGIMGHEKELIFDANFTFKEGEAVEVDEETAAILRNSRFAHDFL
FTPVEASLLAPQTKVIIRDPFKLAEESDKMKPRCAPEGTGGCCGKRKSC

hide sequence

RefSeq Acc Id:

ENSRNOP00000027223 ⟸ ENSRNOT00000027223

RefSeq Acc Id:	XP_038938624 ⟸ XM_039082696
- Peptide Label:	isoform X3
- UniProtKB:	Q8VHT6 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_038938593 ⟸ XM_039082665
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063127220 ⟸ XM_063271150
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063127291 ⟸ XM_063271221
- Peptide Label:	isoform X4

Protein Domains

Methyltransferase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8VHT6-F1-model_v2	AlphaFold	Q8VHT6	1-369	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690973

Promoter ID:

EPDNEW_R1497

Type:

initiation region

Name:

As3mt_1

Description:

arsenite methyltransferase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	266,482,827 - 266,482,887	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621325	AgrOrtholog
BioCyc Gene	G2FUF-55498	BioCyc
Ensembl Genes	ENSRNOG00000020081	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
	ENSRNOG00060029581	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000027223	ENTREZGENE
	ENSRNOT00000027223.7	UniProtKB/TrEMBL
	ENSRNOT00060051439	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.5.100	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	3.40.50.150	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:6918024	IMAGE-MGC_LOAD
InterPro	Arsenite_MeTrfase-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Methyltranfer_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SAM-dependent_MTases	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:140925	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72713	IMAGE-MGC_LOAD
NCBI Gene	140925	ENTREZGENE
PANTHER	ARSENITE METHYLTRANSFERASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR43675	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Methyltransf_31	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PharmGKB	AS3MT	RGD
PhenoGen	As3mt	PhenoGen
RatGTEx	ENSRNOG00000020081	RatGTEx
	ENSRNOG00060029581	RatGTEx
Superfamily-SCOP	SSF53335	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6JHN7	ENTREZGENE, UniProtKB/TrEMBL
	A6JHN8_RAT	UniProtKB/TrEMBL
	A6JHN9_RAT	UniProtKB/TrEMBL
	AS3MT_RAT	UniProtKB/Swiss-Prot
	G3V8P2	ENTREZGENE, UniProtKB/TrEMBL
	Q6P7S7_RAT	UniProtKB/TrEMBL
	Q8VHT6	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2014-05-21	As3mt	arsenite methyltransferase	As3mt	arsenic (+3 oxidation state) methyltransferase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-01-30	As3mt	arsenic (+3 oxidation state) methyltransferase	Cyt19		Data merged from RGD:1354668	737654	APPROVED
2005-01-20	As3mt	arsenic (+3 oxidation state) methyltransferase	Cyt19	methyltransferase Cyt19	Symbol and Name updated	1299863	APPROVED
2002-08-07	Cyt19	methyltransferase Cyt19			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_protein	369-amino acid residues and a molecular mass of 4,1056	625365

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations