Hnrnph1 (heterogeneous nuclear ribonucleoprotein H1)

Gene: Hnrnph1 (heterogeneous nuclear ribonucleoprotein H1) Rattus norvegicus

Analyze

Symbol:

Hnrnph1

Name:

heterogeneous nuclear ribonucleoprotein H1

RGD ID:

620840

Description:

Enables enzyme binding activity. Involved in cellular response to peptide. Located in nucleoplasm. Is active in postsynaptic density. Human ortholog(s) of this gene implicated in Sjogren's syndrome. Orthologous to human HNRNPH1 (heterogeneous nuclear ribonucleoprotein H1); PARTICIPATES IN spliceosome pathway; INTERACTS WITH 1-bromopropane; 17alpha-ethynylestradiol; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

heterogeneous nuclear ribonucleoprotein H; hnRNP H; Hnrph; Hnrph1; MGC124573; ratsg1

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	35,187,412 - 35,203,909 (+)	NCBI		GRCr8
mRatBN7.2	10	34,692,868 - 34,702,849 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	34,693,555 - 34,702,846 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	39,365,683 - 39,374,987 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	7,904,939 - 7,914,243 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	34,359,365 - 34,368,669 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	35,872,619 - 35,879,911 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	35,870,232 - 35,879,910 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	35,644,079 - 35,651,370 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	35,922,840 - 35,930,132 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	35,923,888 - 35,931,180 (+)	NCBI
Celera	10	34,044,661 - 34,051,957 (+)	NCBI		Celera
Cytogenetic Map	10	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Colorectal Neoplasms (ISO)

Ehlers-Danlos syndrome dermatosparaxis type (ISO)

Experimental Autoimmune Orchitis (IDA)

frontotemporal dementia and/or amyotrophic lateral sclerosis 1 (ISO)

genetic disease (ISO)

hepatocellular carcinoma (ISO)

Neurodevelopmental Disorder with Craniofacial Dysmorphism and Skeletal Defects (ISO)

Prostatic Neoplasms (ISO)

Sjogren's syndrome (ISO)

Sotos syndrome (ISO)

syndromic X-linked intellectual developmental disorder Bain type (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

1-bromopropane (EXP)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP,ISO)

17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP)

2,6-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

2-palmitoylglycerol (ISO)

3',5'-cyclic UMP (ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-chloropropane-1,2-diol (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (EXP)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

acrolein (ISO)

afimoxifene (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

aminoglutethimide (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP,ISO)

bufalin (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

caffeine (ISO)

captan (ISO)

carbon nanotube (ISO)

ceruletide (EXP)

chloropicrin (ISO)

chromium(6+) (ISO)

chrysene (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

copper(II) sulfate (ISO)

coumarin (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

DDE (ISO)

dexamethasone (ISO)

diallyl trisulfide (ISO)

diarsenic trioxide (ISO)

diazinon (ISO)

dicrotophos (ISO)

diethyl maleate (ISO)

diethylstilbestrol (ISO)

diuron (EXP)

dorsomorphin (ISO)

endosulfan (EXP)

Enterolactone (ISO)

enzyme inhibitor (ISO)

ethanol (ISO)

flutamide (EXP)

folic acid (ISO)

folpet (ISO)

FR900359 (ISO)

fulvestrant (ISO)

furan (EXP)

genistein (EXP)

gentamycin (EXP)

herbicide (ISO)

hyaluronic acid (EXP)

hydrogen peroxide (EXP,ISO)

indometacin (ISO)

ivermectin (ISO)

lead(0) (ISO)

methotrexate (ISO)

methyl methanesulfonate (ISO)

metolachlor (ISO)

ozone (ISO)

paclitaxel (ISO)

paracetamol (EXP,ISO)

paraquat (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenylmercury acetate (ISO)

potassium chromate (ISO)

progesterone (EXP)

quercetin (ISO)

rac-lactic acid (ISO)

raloxifene (ISO)

resveratrol (ISO)

rotenone (ISO)

sarin (EXP)

SB 431542 (ISO)

serpentine asbestos (ISO)

silicon dioxide (ISO)

sodium dichromate (ISO)

succimer (ISO)

sulforaphane (ISO)

sunitinib (ISO)

T-2 toxin (EXP)

tamoxifen (ISO)

tetrachloromethane (EXP,ISO)

tetraphene (ISO)

thioacetamide (EXP)

tolcapone (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

triptonide (ISO)

valproic acid (ISO)

vinclozolin (EXP)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to interleukin-7 (ISO)

cellular response to peptide (IEP)

mRNA processing (IEA)

regulation of RNA splicing (IBA,IEA,ISO,ISS)

RNA processing (TAS)

RNA splicing (IEA)

Cellular Component

catalytic step 2 spliceosome (IEA,ISO)

cytosol (IEA,ISO)

nucleoplasm (IBA,IDA,IEA,ISO)

nucleus (ISO)

postsynaptic density (EXP,IDA)

ribonucleoprotein complex (IBA,IEA)

Molecular Function

enzyme binding (IPI)

identical protein binding (IEA,ISO)

protein binding (ISO)

RNA binding (IBA,IEA,ISO,ISS)

Molecular Pathway Annotations Click to see Annotation Detail View

spliceosome pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Proteomic analysis of in vivo-assembled pre-mRNA splicing complexes expands the catalog of participating factors.	Chen YI, etal., Nucleic Acids Res. 2007;35(12):3928-44. Epub 2007 May 30.
2.	Mitogenic insulin receptor-A is overexpressed in human hepatocellular carcinoma due to EGFR-mediated dysregulation of RNA splicing factors.	Chettouh H, etal., Cancer Res. 2013 Jul 1;73(13):3974-86. doi: 10.1158/0008-5472.CAN-12-3824. Epub 2013 Apr 30.
3.	Identification of immunodominant autoantigens in rat autoimmune orchitis.	Fijak M, etal., J Pathol. 2005 Oct;207(2):127-38.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
6.	The expression profile of RNA-binding proteins in primary and metastatic colorectal cancer: relationship of heterogeneous nuclear ribonucleoproteins with prognosis.	Hope NR and Murray GI, Hum Pathol. 2011 Mar;42(3):393-402. doi: 10.1016/j.humpath.2010.08.006. Epub 2010 Dec 30.
7.	Proteomics analysis of rat brain postsynaptic density. Implications of the diverse protein functional groups for the integration of synaptic physiology.	Li KW, etal., J Biol Chem. 2004 Jan 9;279(2):987-1002. doi: 10.1074/jbc.M303116200. Epub 2003 Oct 7.
8.	Proteomic study of amyloid beta (25-35) peptide exposure to neuronal cells: Impact on APE1/Ref-1's protein-protein interaction.	Mantha AK, etal., J Neurosci Res. 2012 Jun;90(6):1230-9. doi: 10.1002/jnr.23018. Epub 2012 Feb 20.
9.	The hnRNP F protein: unique primary structure, nucleic acid-binding properties, and subcellular localization.	Matunis MJ, etal., Nucleic Acids Res 1994 Mar 25;22(6):1059-67.
10.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.	GOA pipeline	RGD automated data pipeline
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Proteomics profiling of nuclear proteins for kidney fibroblasts suggests hypoxia, meiosis, and cancer may meet in the nucleus.	Shakib K, etal., Proteomics. 2005 Jul;5(11):2819-38.
14.	Heterogeneous nuclear ribonucleoprotein h1, a novel nuclear autoantigen.	Van den Bergh K, etal., Clin Chem. 2009 May;55(5):946-54. doi: 10.1373/clinchem.2008.115626. Epub 2009 Mar 5.
15.	Differentially expressed proteins in cerulein-stimulated pancreatic acinar cells: implication for acute pancreatitis.	Yu JH, etal., Int J Biochem Cell Biol. 2008;40(3):503-16. Epub 2007 Sep 16.

Additional References at PubMed

PMID:1302261	PMID:11991638	PMID:12477932	PMID:16854843	PMID:16946708	PMID:18573884	PMID:19946888	PMID:22658674	PMID:22681889	PMID:24625528	PMID:24910439	PMID:26316108
PMID:27117401	PMID:29476059	PMID:29581031	PMID:30361391	PMID:31505169	PMID:35352799

Genomics

Comparative Map Data

Hnrnph1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	35,187,412 - 35,203,909 (+)	NCBI		GRCr8
mRatBN7.2	10	34,692,868 - 34,702,849 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	34,693,555 - 34,702,846 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	39,365,683 - 39,374,987 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	7,904,939 - 7,914,243 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	34,359,365 - 34,368,669 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	35,872,619 - 35,879,911 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	35,870,232 - 35,879,910 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	35,644,079 - 35,651,370 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	35,922,840 - 35,930,132 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	35,923,888 - 35,931,180 (+)	NCBI
Celera	10	34,044,661 - 34,051,957 (+)	NCBI		Celera
Cytogenetic Map	10	q22	NCBI

HNRNPH1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	179,614,178 - 179,634,784 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	179,614,178 - 179,634,784 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	179,041,179 - 179,061,785 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	178,973,786 - 178,983,276 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	178,973,785 - 178,983,276	NCBI
Celera	5	174,670,146 - 174,679,127 (-)	NCBI		Celera
Cytogenetic Map	5	q35.3	NCBI
HuRef	5	173,768,106 - 173,777,652 (-)	NCBI		HuRef
CHM1_1	5	178,473,644 - 178,483,178 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	180,168,628 - 180,189,994 (-)	NCBI		T2T-CHM13v2.0

Hnrnph1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	50,266,084 - 50,277,355 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	50,267,817 - 50,277,355 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	50,375,257 - 50,386,528 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	50,376,990 - 50,386,528 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	50,191,221 - 50,200,030 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	50,221,186 - 50,229,948 (+)	NCBI		MGSCv36	mm8
Celera	11	54,938,368 - 54,947,177 (+)	NCBI		Celera
Cytogenetic Map	11	B1.3	NCBI
cM Map	11	30.56	NCBI

Hnrnph1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955408	936,595 - 948,064 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955408	937,706 - 944,969 (+)	NCBI	ChiLan1.0	ChiLan1.0

HNRNPH1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	174,553,279 - 174,563,705 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	172,692,818 - 172,703,189 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	174,764,771 - 174,775,201 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	182,044,229 - 182,053,647 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	182,044,549 - 182,053,635 (-)	Ensembl	panpan1.1		panPan2

HNRNPH1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	2,050,753 - 2,059,999 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	2,050,871 - 2,059,999 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	2,173,488 - 2,182,754 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	2,025,055 - 2,034,321 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	2,025,089 - 2,034,094 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	1,996,529 - 2,005,793 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	2,075,126 - 2,084,395 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	2,315,878 - 2,325,144 (+)	NCBI		UU_Cfam_GSD_1.0

Hnrnph1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	119,925,451 - 119,934,866 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936739	1,135,289 - 1,144,643 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936739	1,135,282 - 1,144,643 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HNRNPH1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	78,963,309 - 78,969,949 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	78,961,456 - 78,971,799 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	80,528,404 - 80,538,405 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HNRNPH1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	81,330,777 - 81,340,470 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	81,330,351 - 81,339,882 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666075	12,697,976 - 12,708,643 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Hnrnph1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624733	42,538,159 - 42,548,249 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624733	42,538,286 - 42,547,911 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Hnrnph1
68 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	118
Count of miRNA genes:	55
Interacting mature miRNAs:	56
Transcripts:	ENSRNOT00000059190, ENSRNOT00000067188
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2293680	Bss40	Bone structure and strength QTL 40	5.66	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	10	1	35225947	Rat
634327	Hc4	Hypercalciuria QTL 4	2.4		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	10	1	38328221	Rat
7411611	Foco17	Food consumption QTL 17	18.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	1	42315980	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	418344	45418344	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5387014	50387014	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5387014	50387014	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5387014	50387014	Rat
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6375746	51375746	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15028513	60430477	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15275955	60275955	Rat
6893350	Bw99	Body weight QTL 99	0.87	0.16	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
6893352	Bw100	Body weight QTL 100	0.33	0.6	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
631532	Cm50	Cardiac mass QTL 50	6.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	17907113	51786432	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18167841	63167841	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	19606483	64606483	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	19606483	64606483	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21329805	61345413	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
631531	Iresp2	Immunoglobin response QTL2	6.3		blood immunoglobulin E amount (VT:0002492)	serum immunoglobulin E level (CMO:0002101)	10	22918268	36400810	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	26521957	61345413	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	26944628	71944628	Rat
10402859	Bp381	Blood pressure QTL 381		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2292441	Bp308	Blood pressure QTL 308			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28453136	73453136	Rat
1600371	Mcs21	Mammary carcinoma susceptibility QTL 21	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	28875650	52200160	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29299504	64155584	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	30632053	75632053	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31224026	75632053	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31297439	76297439	Rat
1576319	Cia29	Collagen induced arthritis QTL 29			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	33973921	78973921	Rat
61332	Eau3	Experimental allergic uveoretinitis QTL 3		0.004	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	34490559	45579777	Rat

Markers in Region

AA900513

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	34,702,518 - 34,702,702 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	35,879,583 - 35,879,766	NCBI	Rnor6.0
Rnor_5.0	10	35,651,042 - 35,651,225	UniSTS	Rnor5.0
RGSC_v3.4	10	35,929,804 - 35,929,987	UniSTS	RGSC3.4
Celera	10	34,051,629 - 34,051,812	UniSTS
RH 3.4 Map	10	369.2	UniSTS
Cytogenetic Map	10	q22	UniSTS

G43520

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	34,697,502 - 34,697,636 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	35,874,567 - 35,874,700	NCBI	Rnor6.0
Rnor_5.0	10	35,646,027 - 35,646,160	UniSTS	Rnor5.0
RGSC_v3.4	10	35,924,788 - 35,924,921	UniSTS	RGSC3.4
Celera	10	34,046,609 - 34,046,742	UniSTS
Cytogenetic Map	10	q22	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High									6
Medium	3	43	57	41	19	41	8	11	68	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_080896	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085094	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085095	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085096	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085097	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085099	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085101	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268352	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268353	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC115159	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF367468	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC099792	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC129087	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212957	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000059190 ⟹ ENSRNOP00000055962

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	34,693,602 - 34,702,846 (+)	Ensembl
Rnor_6.0 Ensembl	10	35,872,619 - 35,879,910 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000067188 ⟹ ENSRNOP00000063584

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	34,693,618 - 34,702,846 (+)	Ensembl
Rnor_6.0 Ensembl	10	35,870,682 - 35,879,910 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000078505 ⟹ ENSRNOP00000068707

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	34,693,555 - 34,701,513 (+)	Ensembl
Rnor_6.0 Ensembl	10	35,870,232 - 35,878,775 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000096910 ⟹ ENSRNOP00000093858

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	34,693,632 - 34,702,845 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000119006 ⟹ ENSRNOP00000079947

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	34,693,632 - 34,702,845 (+)	Ensembl

RefSeq Acc Id:

NM_080896 ⟹ NP_543172

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	35,194,633 - 35,203,909 (+)	NCBI
mRatBN7.2	10	34,693,573 - 34,702,849 (+)	NCBI
Rnor_6.0	10	35,872,619 - 35,879,911 (+)	NCBI
Rnor_5.0	10	35,644,079 - 35,651,370 (+)	NCBI
RGSC_v3.4	10	35,922,840 - 35,930,132 (+)	RGD
Celera	10	34,044,661 - 34,051,957 (+)	RGD

Sequence:

show sequence

GAATTCGGCACCAGGTTGAACTTGAATCAGAAGATGAAGTCAAATTGGCCTTGAAAAAAGACAG
AGAAACTATGGGACACAGATATGTTGAAGTATTCAAGTCAAACAACGTTGAAATGGATTGGGTG
TTGAAGCATACTGGTCCCAATAGTCCTGACACGGCCAATGATGGCTTTGTACGGCTTAGAGGAC
TCCCTTTTGGATGTAGCGAGGAAGAAATTGTTCAGTTCTTCTCAGGGTTGGAAATCGTGCCAAA
TGGGATAACATTGCCGGTGGACTTCCAGGGGAGGAGTACGGGGGAGGCCTTCGTGCAGTTTGCT
TCACAGGAAATAGCTGAAAAGGCTCTAAAGAAACACAAGGAAAGAATAGGGCACAGGTATATTG
AAATATTTAAGAGCAGTCGAGCTGAAGTTAGAACTCATTATGATCCACCACGAAAACTTATGGC
CATGCAGCGGCCAGGTCCCTATGACAGACCTGGGGCTGGCAGAGGGTATAACAGCATTGGCAGA
GGAGCTGGCTTTGAGAGGATGAGGCGTGGTGCTTATGGTGGAGGCTATGGAGGCTATGATGATT
ATAATGGCTATAATGATGGCTATGGATTTGGTTCGGATAGATTTGGAAGAGACCTCAATTATTG
TTTTTCAGGAATGTCTGACCACAGATATGGGGATGGTGGCTCCACTTTCCAGAGTACAACAGGA
CACTGTGTACACATGCGGGGATTACCATACAGAGCTACTGAGAATGACATTTATAATTTTTTTT
CACCACTCAACCCTGTGAGAGTACATATTGAGACTGGACCTGATGGCAGAGTAACTGGTGAAGC
AGATGTTGAGTTTGCAACCCATGAAGATGCTGTTGCAGCTATGTCAAAAGATAAAGCAAATATG
CAACACAGATATGTAGAACTCTTCTTGAATTCTACAGCAGGAGCAAGCGGTGGTGCTTACGAAC
ACAGATATGTAGAACTCTTCTTGAATTCTACAGCAGGAGCAAGCGGTGGTGCTTATGGTAGCCA
AATGATGGGAGGCATGGGCTTGTCAAACCAGTCCAGTTACGGTGGCCCAGCCAGCCAGCAGCTG
AGTGGTGGTTATGGAGGTGGCTATGGTGGCCAGAGCAGCATGAGCGGATATGACCAAGTTTTAC
AGGAAAACTCCAGTGATTTTCAATCAAACATTGCATAGGTAGCCAAGGAGCAGTGAACAGCAGC
TACTACAGTAGCGGAAGCCGTGCATATATGGGCGTGAATGGAATGGGAGGGATGTCTAGCATGT
CTAGTATGAGTGGTGGATGGGGAATGTAATTGATTTTGATCACTGACTCTTGGTCAAAAAGAAA
TTTTTTTAAAACCCTTCAGTTTAACAGTTTTTGCAATCCAGCCTTGTGGTTTTAATGCCTGCTC
TCTTAAGTGAACTTTGGCATCGATCGCTCAAAGAAGGTTCAATGTTGAACATAGCAGTCACCTA
GGATGATAGGGCAAAGTTGAGTAACTTTAACTGTTAAACTTAATTCCTAGCTTTTCTCTAGTTA
TGTAGGATGTACGTAAGCAGTAAGTGTACTTAGGTTAAAGCAGTTGAATTATGTTAAATGTTGC
TCTTATACATACATACATTGAACACTGTTGATGCATGTTGAAAAGACATGCTTTTTTTGTAAAA
CTACAGGAGCTGCGTCTACAATTAAAAGTGAAACATTTGGCATGTTTGTTAATTCTAAATTCAT
TTGATAACCTGTAAGGCACGTGAGTTTAAAGCTCTTTTCTTTTTTTAAGTTAATGGAGAAATTC
TGAGACGCAATACCATTACTTTTTAGGATTTTTGGTCTTGGTGTTTGTACGAAATTCTGAGGCC
TTGATTTAAGTCTTTCATTGTATTGTGATTTACTTTTAGGTGTATTGCGCTAAGTGAACCTTGT
CAAATAAATCTTCCTTTTAAAAGCTAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039085094 ⟹ XP_038941022

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	35,194,549 - 35,203,907 (+)	NCBI
mRatBN7.2	10	34,693,489 - 34,702,847 (+)	NCBI

RefSeq Acc Id:

XM_039085095 ⟹ XP_038941023

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	35,194,689 - 35,203,907 (+)	NCBI
mRatBN7.2	10	34,693,695 - 34,702,277 (+)	NCBI

RefSeq Acc Id:

XM_039085096 ⟹ XP_038941024

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	35,187,412 - 35,203,907 (+)	NCBI
mRatBN7.2	10	34,692,868 - 34,702,277 (+)	NCBI

RefSeq Acc Id:

XM_039085097 ⟹ XP_038941025

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	35,194,696 - 35,203,907 (+)	NCBI
mRatBN7.2	10	34,693,636 - 34,702,277 (+)	NCBI

RefSeq Acc Id:

XM_039085099 ⟹ XP_038941027

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	35,194,548 - 35,203,907 (+)	NCBI
mRatBN7.2	10	34,693,489 - 34,702,847 (+)	NCBI

RefSeq Acc Id:

XM_039085101 ⟹ XP_038941029

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	35,194,549 - 35,203,345 (+)	NCBI
mRatBN7.2	10	34,693,489 - 34,702,847 (+)	NCBI

RefSeq Acc Id:

XM_063268352 ⟹ XP_063124422

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	35,187,412 - 35,203,345 (+)	NCBI

RefSeq Acc Id:

XM_063268353 ⟹ XP_063124423

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	35,196,897 - 35,203,907 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_543172	(Get FASTA)	NCBI Sequence Viewer
	XP_038941022	(Get FASTA)	NCBI Sequence Viewer
	XP_038941023	(Get FASTA)	NCBI Sequence Viewer
	XP_038941024	(Get FASTA)	NCBI Sequence Viewer
	XP_038941025	(Get FASTA)	NCBI Sequence Viewer
	XP_038941027	(Get FASTA)	NCBI Sequence Viewer
	XP_038941029	(Get FASTA)	NCBI Sequence Viewer
	XP_063124422	(Get FASTA)	NCBI Sequence Viewer
	XP_063124423	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH99792	(Get FASTA)	NCBI Sequence Viewer
	AAI29088	(Get FASTA)	NCBI Sequence Viewer
	AAL59557	(Get FASTA)	NCBI Sequence Viewer
	EDM04272	(Get FASTA)	NCBI Sequence Viewer
	EDM04273	(Get FASTA)	NCBI Sequence Viewer
	EDM04274	(Get FASTA)	NCBI Sequence Viewer
	EDM04275	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000055962
	ENSRNOP00000055962.4
	ENSRNOP00000063584.2
	ENSRNOP00000068707.2
	ENSRNOP00000079947
	ENSRNOP00000079947.1
	ENSRNOP00000093858
	ENSRNOP00000093858.1
GenBank Protein	Q8VHV7	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_543172 ⟸ NM_080896

- UniProtKB:

Q8VHV7 (UniProtKB/Swiss-Prot), A1L1J1 (UniProtKB/Swiss-Prot), A6HE17 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGHRYVEVFKSNNVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSEEEIVQFFSGLEIVPNGI
TLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQ
RPGPYDRPGAGRGYNSIGRGAGFERMRRGAYGGGYGGYDDYNGYNDGYGFGSDRFGRDLNYCFS
GMSDHRYGDGGSTFQSTTGHCVHMRGLPYRATENDIYNFFSPLNPVRVHIETGPDGRVTGEADV
EFATHEDAVAAMSKDKANMQHRYVELFLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMM
GGMGLSNQSSYGGPASQQLSGGYGGGYGGQSSMSGYDQVLQENSSDFQSNIA

hide sequence

RefSeq Acc Id:

ENSRNOP00000063584 ⟸ ENSRNOT00000067188

RefSeq Acc Id:

ENSRNOP00000068707 ⟸ ENSRNOT00000078505

RefSeq Acc Id:

ENSRNOP00000055962 ⟸ ENSRNOT00000059190

RefSeq Acc Id:	XP_038941024 ⟸ XM_039085096
- Peptide Label:	isoform X1
- UniProtKB:	Q8VHV7 (UniProtKB/Swiss-Prot), A1L1J1 (UniProtKB/Swiss-Prot), A0A8I6G5X8 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038941029 ⟸ XM_039085101
- Peptide Label:	isoform X4
- UniProtKB:	Q8VHV7 (UniProtKB/Swiss-Prot), A1L1J1 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_038941027 ⟸ XM_039085099
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I6AGL3 (UniProtKB/TrEMBL), G3V9Q3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038941022 ⟸ XM_039085094
- Peptide Label:	isoform X1
- UniProtKB:	Q8VHV7 (UniProtKB/Swiss-Prot), A1L1J1 (UniProtKB/Swiss-Prot), A0A8I6G5X8 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038941025 ⟸ XM_039085097
- Peptide Label:	isoform X1
- UniProtKB:	Q8VHV7 (UniProtKB/Swiss-Prot), A1L1J1 (UniProtKB/Swiss-Prot), A0A8I6G5X8 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038941023 ⟸ XM_039085095
- Peptide Label:	isoform X1
- UniProtKB:	Q8VHV7 (UniProtKB/Swiss-Prot), A1L1J1 (UniProtKB/Swiss-Prot), A0A8I6G5X8 (UniProtKB/TrEMBL)

RefSeq Acc Id:

ENSRNOP00000079947 ⟸ ENSRNOT00000119006

RefSeq Acc Id:

ENSRNOP00000093858 ⟸ ENSRNOT00000096910

RefSeq Acc Id:	XP_063124422 ⟸ XM_063268352
- Peptide Label:	isoform X3
- UniProtKB:	A6HE17 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063124423 ⟸ XM_063268353
- Peptide Label:	isoform X5

Protein Domains

RRM

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8VHV7-F1-model_v2	AlphaFold	Q8VHV7	1-449	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697161

Promoter ID:

EPDNEW_R7679

Type:

multiple initiation site

Name:

Hnrnph1_1

Description:

heterogeneous nuclear ribonucleoprotein H1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	35,870,672 - 35,870,732	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620840	AgrOrtholog
BioCyc Gene	G2FUF-25239	BioCyc
Ensembl Genes	ENSRNOG00000003399	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000059190	ENTREZGENE
	ENSRNOT00000059190.5	UniProtKB/TrEMBL
	ENSRNOT00000067188.3	UniProtKB/TrEMBL
	ENSRNOT00000078505.2	UniProtKB/TrEMBL
	ENSRNOT00000096910.1	UniProtKB/TrEMBL
	ENSRNOT00000119006.1	UniProtKB/TrEMBL
Gene3D-CATH	3.30.70.330	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:8363754	IMAGE-MGC_LOAD
InterPro	Nucleotide-bd_a/b_plait_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RBD_domain_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RRM_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Znf_CHHC	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:140931	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:156600	IMAGE-MGC_LOAD
NCBI Gene	140931	ENTREZGENE
PANTHER	HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN H	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	RRM_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	zf-RNPHF	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Hnrnph1	PhenoGen
PROSITE	RRM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000003399	RatGTEx
SMART	RRM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF54928	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2JTG7_RAT	UniProtKB/TrEMBL
	A0A8I6AGL3	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6G5X8	ENTREZGENE, UniProtKB/TrEMBL
	A1L1J1	ENTREZGENE
	A6HE17	ENTREZGENE, UniProtKB/TrEMBL
	G3V9Q3	ENTREZGENE, UniProtKB/TrEMBL
	HNRH1_RAT	UniProtKB/Swiss-Prot
	Q499R8_RAT	UniProtKB/TrEMBL
	Q8VHV7	ENTREZGENE
UniProt Secondary	A1L1J1	UniProtKB/Swiss-Prot
	D3ZYW2	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-08-01	Hnrnph1	heterogeneous nuclear ribonucleoprotein H1	Hnrph1	heterogeneous nuclear ribonucleoprotein H1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Hnrph1	heterogeneous nuclear ribonucleoprotein H1	Hnrnph1		Symbol updated	1299863	APPROVED
2002-08-07	Hnrnph1	heterogeneous nuclear ribonucleoprotein H1			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations