Grk1 (G protein-coupled receptor kinase 1)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Gene: Grk1 (G protein-coupled receptor kinase 1) Rattus norvegicus

Analyze

Symbol:

Grk1

Name:

G protein-coupled receptor kinase 1

RGD ID:

619712

Description:

Enables rhodopsin kinase activity. Involved in response to light stimulus and response to xenobiotic stimulus. Predicted to be located in photoreceptor outer segment. Predicted to be active in cytoplasm. Used to study congestive heart failure. Biomarker of retinal disease. Human ortholog(s) of this gene implicated in Oguchi disease-2 and night blindness. Orthologous to human GRK1 (G protein-coupled receptor kinase 1); PARTICIPATES IN visual phototransduction pathway; chemokine mediated signaling pathway; endocytosis pathway; INTERACTS WITH 2,4-dinitrotoluene; 6-propyl-2-thiouracil; ammonium chloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

G protein-coupled receptpr kinase 1; rhodopsin kinase; rhodopsin kinase GRK1; Rhok; RK

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GRK1 (G protein-coupled receptor kinase 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Grk1 (G protein-coupled receptor kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Grk1 (G protein-coupled receptor kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GRK1 (G protein-coupled receptor kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GRK1 (G protein-coupled receptor kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Grk1 (G protein-coupled receptor kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GRK1 (G protein-coupled receptor kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GRK1 (G protein-coupled receptor kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Grk1 (G protein-coupled receptor kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Grk1 (G protein-coupled receptor kinase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	GRK1 (G protein-coupled receptor kinase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	grk1a (G protein-coupled receptor kinase 1 a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	grk-1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	Gprk2	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	grk1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Allele / Splice:

Grk1^{Tn(sb-T2/Bart3)2.234Mcwi}

Genetic Models:

F344-Grk1^{Tn(sb-T2/Bart3)2.234Mcwi}

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	82,821,184 - 82,837,971 (-)	NCBI		GRCr8
mRatBN7.2	16	76,122,501 - 76,135,792 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	76,123,842 - 76,135,792 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	81,404,428 - 81,416,381 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	84,857,390 - 84,869,343 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	80,106,227 - 80,118,183 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	81,153,489 - 81,165,442 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	81,153,489 - 81,165,442 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	80,641,991 - 80,657,693 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	80,979,323 - 80,991,796 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	80,979,589 - 80,992,061 (-)	NCBI
Celera	16	73,931,302 - 73,943,259 (-)	NCBI		Celera
Cytogenetic Map	16	q12.5	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

congenital stationary night blindness (ISO)

congestive heart failure (IDA)

Experimental Diabetes Mellitus (IEP)

factor X deficiency (ISO)

genetic disease (ISO)

hereditary night blindness (ISO)

Neuralgia (ISO)

night blindness (ISO)

Oguchi disease-2 (ISO,ISS)

retinal disease (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,4-dinitrotoluene (EXP)

6-propyl-2-thiouracil (EXP)

Aflatoxin B2 alpha (ISO)

ammonium chloride (EXP)

atrazine (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

C60 fullerene (EXP)

CGP 52608 (ISO)

cyclosporin A (ISO)

diazinon (EXP)

dinitrogen (ISO)

dioxygen (ISO)

epoxiconazole (ISO)

fulvestrant (ISO)

iodoacetic acid (ISO)

lead diacetate (EXP)

malathion (ISO)

methapyrilene (ISO)

methoxychlor (EXP)

metipranolol (EXP)

octreotide (ISO)

resveratrol (ISO)

sodium arsenite (ISO)

trichloroethene (EXP)

triptonide (ISO)

valproic acid (ISO)

zinc atom (EXP)

zinc sulfate (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic process (ISO)

negative regulation of neuron apoptotic process (ISO)

photoreceptor cell morphogenesis (ISO)

positive regulation of phosphorylation (ISO)

post-embryonic retina morphogenesis in camera-type eye (ISO)

protein autophosphorylation (IDA)

regulation of opsin-mediated signaling pathway (IEA,ISO,ISS)

regulation of signal transduction (IBA)

response to light stimulus (IEP,ISO)

response to xenobiotic stimulus (IEP)

retinal rod cell apoptotic process (ISO)

rhodopsin mediated signaling pathway (TAS)

signal transduction (IEA)

visual perception (IEA)

Cellular Component

cytoplasm (IBA,IEA,ISO)

membrane (IEA)

photoreceptor outer segment (ISO)

Molecular Function

ATP binding (IEA)

rhodopsin kinase activity (IBA,IDA,IEA,ISO,TAS)

Molecular Pathway Annotations Click to see Annotation Detail View

chemokine mediated signaling pathway (IEA)

endocytosis pathway (IEA)

visual phototransduction pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	In vivo farnesylation of rat rhodopsin kinase.	Anant JS and Fung BK, Biochem Biophys Res Commun. 1992 Mar 16;183(2):468-73.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Impaired coronary function in Wistar Ottawa Karlsburg W rats-a new model of the metabolic syndrome.	Grisk O, etal., Pflugers Arch. 2007 Sep;454(6):1011-21. Epub 2007 May 1.
5.	G protein-coupled receptor kinases: more than just kinases and not only for GPCRs.	Gurevich EV, etal., Pharmacol Ther. 2012 Jan;133(1):40-69. Epub 2011 Aug 26.
6.	Development and regulation of rhodopsin kinase in rat pineal and retina.	Ho AK, etal., J Neurochem. 1986 Apr;46(4):1176-9.
7.	The rho/rho-kinase pathway is involved in the progression of testicular germ cell tumour.	Kamai T, etal., BJU Int. 2002 Mar;89(4):449-53.
8.	Changes in rhodopsin kinase and transducin in the rat retina in early-stage diabetes.	Kim YH, etal., Exp Eye Res. 2005 Jun;80(6):753-60.
9.	Ventricular hypertrophy plus neurohumoral activation is necessary to alter the cardiac beta-adrenoceptor system in experimental heart failure.	Leineweber K, etal., Circ Res. 2002 Nov 29;91(11):1056-62.
10.	Low expression of alphaA-crystallins and rhodopsin kinase of photoreceptors in retinal dystrophy rat.	Maeda A, etal., Invest Ophthalmol Vis Sci. 1999 Nov;40(12):2788-94.
11.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
12.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
14.	Molecular, enzymatic and functional properties of rhodopsin kinase from rat pineal gland.	Palczewski K, etal., Vision Res. 1990;30(8):1129-37.
15.	Effects of a Rho kinase inhibitor on pressure overload induced cardiac hypertrophy and associated diastolic dysfunction.	Phrommintikul A, etal., Am J Physiol Heart Circ Physiol. 2008 Apr;294(4):H1804-14. Epub 2008 Feb 1.
16.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
17.	GOA pipeline	RGD automated data pipeline
18.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
19.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
20.	Comprehensive gene review and curation	RGD comprehensive gene curation
21.	Defects in the rhodopsin kinase gene in the Oguchi form of stationary night blindness.	Yamamoto S, etal., Nat Genet. 1997 Feb;15(2):175-8.
22.	Preservation of retinal morphology and functions in royal college surgeons rat by nilvadipine, a Ca(2+) antagonist.	Yamazaki H, etal., Invest Ophthalmol Vis Sci. 2002 Apr;43(4):919-26.
23.	Molecular cloning and localization of rhodopsin kinase in the mammalian pineal.	Zhao X, etal., Vis Neurosci 1997 Mar-Apr;14(2):225-32.

Additional References at PubMed

PMID:10097103	PMID:15946941	PMID:22183407	PMID:24914207	PMID:26350504

Genomics

Comparative Map Data

Grk1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	82,821,184 - 82,837,971 (-)	NCBI		GRCr8
mRatBN7.2	16	76,122,501 - 76,135,792 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	76,123,842 - 76,135,792 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	81,404,428 - 81,416,381 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	84,857,390 - 84,869,343 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	80,106,227 - 80,118,183 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	81,153,489 - 81,165,442 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	81,153,489 - 81,165,442 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	80,641,991 - 80,657,693 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	80,979,323 - 80,991,796 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	80,979,589 - 80,992,061 (-)	NCBI
Celera	16	73,931,302 - 73,943,259 (-)	NCBI		Celera
Cytogenetic Map	16	q12.5	NCBI

GRK1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	13	113,648,199 - 113,737,736 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	13	113,667,219 - 113,737,736 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	13	114,321,534 - 114,440,709 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	13	113,369,595 - 113,373,975 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	13	113,369,597 - 113,373,973	NCBI
Celera	13	95,148,890 - 95,166,521 (+)	NCBI		Celera
Cytogenetic Map	13	q34	NCBI
HuRef	13	94,993,393 - 94,997,833 (-)	NCBI		HuRef
HuRef	13	94,760,843 - 94,763,381 (+)	NCBI		HuRef
CHM1_1	13	114,395,320 - 114,407,284 (+)	NCBI		CHM1_1
CHM1_1	13	114,290,923 - 114,295,255 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	13	112,903,498 - 112,947,029 (+)	NCBI		T2T-CHM13v2.0

Grk1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	13,455,081 - 13,471,951 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	13,455,081 - 13,471,951 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	13,405,081 - 13,421,951 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	13,405,081 - 13,421,951 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	13,405,081 - 13,421,951 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	13,405,058 - 13,417,557 (+)	NCBI		MGSCv36	mm8
Celera	8	13,573,519 - 13,590,102 (+)	NCBI		Celera
Cytogenetic Map	8	A1.1	NCBI
cM Map	8	5.93	NCBI

Grk1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955404	343,009 - 353,683 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955404	343,009 - 353,683 (-)	NCBI	ChiLan1.0	ChiLan1.0

GRK1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	14	115,179,766 - 115,204,613 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	13	113,871,114 - 113,897,632 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	13	94,816,045 - 94,838,509 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	13	113,867,002 - 113,885,610 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	13	113,867,002 - 113,885,610 (+)	Ensembl	panpan1.1		panPan2

GRK1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	22	60,911,953 - 60,929,330 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	22	60,911,953 - 60,926,146 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	22	60,622,827 - 60,638,762 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	22	61,596,581 - 61,612,683 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	22	61,596,581 - 61,609,597 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	22	61,035,074 - 61,051,125 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	22	61,037,157 - 61,053,062 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	22	61,068,208 - 61,084,263 (+)	NCBI		UU_Cfam_GSD_1.0

Grk1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	195,787,031 - 195,800,023 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936472	151,854 - 165,281 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936472	152,202 - 165,134 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GRK1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	11	78,793,777 - 78,804,262 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	11	78,793,670 - 78,803,291 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	11	86,527,109 - 86,537,944 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GRK1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	3	91,633,902 - 91,655,989 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	3	91,636,813 - 91,653,521 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666046	48,723,661 - 48,741,396 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Grk1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624793	453,125 - 462,053 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624793	453,125 - 462,053 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Grk1
25 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	42
Count of miRNA genes:	40
Interacting mature miRNAs:	42
Transcripts:	ENSRNOT00000024999
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	380245	80345693	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor depth of invasion (CMO:0001888)	16	17696791	82635055	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor depth of invasion (CMO:0001888)	16	17696791	82635055	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17696791	82635055	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17696791	82635055	Rat
1578768	Stresp22	Stress response QTL 22	2.8		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	16	35288870	80288870	Rat
2293690	Bss45	Bone structure and strength QTL 45	5.13	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	16	37752156	82752156	Rat
2300163	Bmd64	Bone mineral density QTL 64	5.3	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	16	37752156	82752156	Rat
7205510	Activ5	Activity QTL 5	3.78	0.00028	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	42396345	84729064	Rat
8694429	Bw164	Body weight QTL 164	5	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	16	52726464	84729064	Rat
8694364	Abfw7	Abdominal fat weight QTL 7	12.22	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	16	52726464	84729064	Rat
7411648	Foco22	Food consumption QTL 22	15	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	52726464	84729064	Rat
631525	Pia14	Pristane induced arthritis QTL 14	4.4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	16	55711087	83402471	Rat

Genetic Models

This gene Grk1 is modified in the following models/strains:

F344-Grk1^{Tn(sb-T2/Bart3)2.234Mcwi}

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031096	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039094857	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC111257	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473970	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U63971	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000024999 ⟹ ENSRNOP00000024999

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	76,123,842 - 76,135,792 (-)	Ensembl
Rnor_6.0 Ensembl	16	81,153,489 - 81,165,442 (+)	Ensembl

RefSeq Acc Id:

NM_031096 ⟹ NP_112358

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	82,826,014 - 82,837,971 (-)	NCBI
mRatBN7.2	16	76,123,834 - 76,135,792 (-)	NCBI
Rnor_6.0	16	81,153,489 - 81,165,442 (+)	NCBI
Rnor_5.0	16	80,641,991 - 80,657,693 (+)	NCBI
RGSC_v3.4	16	80,979,323 - 80,991,796 (-)	RGD
Celera	16	73,931,302 - 73,943,259 (-)	RGD

Sequence:

show sequence

CCTGGCCATTCGGTGGGATCCCAAGCACCCTGGCCACGGCCGTGTGCCTCCCTTTGTCCCACAA
GGGCAGGAACAGGCCATAGGCCAAGGGCACCAGGTCAAGCCTGCTTTGGCTGCTGGTGCCTTGA
GCTTGACTTCAGCTTATGGGTCTTAACACTTGAAGTGGACACAGGGCATCAGCAGGATGGATTT
CGGGTCCTTGGAAACCGTGGTGGCCAACTCTGCCTTCATTGCGGCCCGAGGCAGCTTTGACGGA
AGCAGCACCCCCTCTTCCCGAGACAAGAAGTATCTGGCCAAGCTCCGGTTGCCCCCACTGTCCA
AGTGTGAGGGTCTCCGTGACAGCATCAGCCTAGAGTTTGACAACCTGTGCTCGGAGCAGCCCAT
TGGCAAGAGGCTCTTCCAGCAGTTCCTGAAGACAGACGAGAGGCATGTGCCGGCTCTGGAGCTC
TGGAAGGACATCGAGGACTATGACACTGCCGATGACGACCTACGGCCACAGAAGGCTCAGGCCA
TCCTGGCTGAGTACCTGGACCCACAGGGCACACTCTTCTGCAACTTCCTGGACCAGGGCATGGT
GGCAAGAGTGAAGGAAGGGCCAACTGGGAGCCAGGATGGGCTCTTCCAGCCTCTGCTGCAGGCC
ACACTGGAGCACTTGAGTCAGGGCCCCTTCCAGGAGTACCTGGGAAGCCTATATTTCCTGCGGT
TTCTTCAGTGGAAGTGGTTGGAAGCCCAGCCCATAGGTGAAGACTGGTTTTTGGACTTCAGGGT
CCTGGGGAAGGGGGGCTTTGGGGAAGTGTCCGCCTGCCAAATGAAGGCGACCGGCAAGATGTAC
GCTTGCAAGAAGCTGAACAAGAAGCGGCTGAAGAAGAGGAAGGGGTACCAGGGCGCCATCGTTG
AGAAGAGGATTCTAGCTAAAGTACACAGCAGGTTCATCGTGTCTCTGGCCTATGCATTCGAAAC
CAAGACCGACCTCTGTCTGGTGATGACCATCATGAATGGAGGTGACGTAAGGTACCACATCTAC
AATGTGGATGAGGAGAACCCCGGCTTTCCGGAGCCACGAGCCATCTACTACACAGCACAGATCA
TCAGTGGCCTGGAGCACCTGCATCAGAGACGCATTGTCTACCGTGACCTCAAGCCAGAGAACGT
GCTGCTGGACAACGATGGCAACATCCGAATTTCTGACCTTGGACTGGCCGTCGAGTTGAAGGAA
GGGCAGAATAAGACCAAGGGCTATGCAGGGACCCCAGGTTTCATGGCCCCCGAGCTCCTGCGAG
GCGAAGAGTACGACTTCTCTGTGGACTACTTTGCCCTGGGGGTCACATTGTACGAGATGATCGC
AGCCAGAGGACCCTTCCGAGCCCGAGGAGAGAAGGTGGAGAACAAGGAGCTTAAACAGCGCATC
ATCTCAGAGCCCGTGAAGTACCCAGAGAAGTTCAGCCAGGCCAGCAAGGACTTCTGTGAGCAGC
TGTTAGAGAAGGACCCGGAGAAGCGCCTGGGTTTCCGGGATGGAACCTGTGACGCCCTAAGGGC
GAATGTCCTCTTCAAAGATATCAGCTGGAGACAGCTCGAAGCCGGAATGCTCATCCCTCCGTTC
ATCCCAGACTCTAGGACTGTCTATGCCAAGAACATTCAGGATGTGGGTGCCTTTTCCACAGTCA
AGGGTGTGGTTTTTGACAAAGCAGACACAGAATTCTTCCAAGAATTCGCCTCCGGCAACTGCTC
CATTCCCTGGCAGGAGGAGATGATTGAGACTGGGTTCTTCGGGGACCTCAACGTGTGGCGCCCA
GACGGTCAAATGCCCGATGACATGAAGGGAATCACCGTGGAGGAGGCAGCCCCTACAGCCAAAT
CAGGGATGTGTCTCATCTCCTAGCCTAGTGTTTGGGGGAAGCCTGGGGCTGGCTGTATAGAGAG
AGGGAAGGATACAGAGCTCAGGGGAGGAGAGTGACCCTGGTGTCAGCCTGTGCCCACTCCATCC
AGGTCACCATGCAACTGTGTCTTCACAAGGAGCCAGCAAGAATCCCGGTTTAGACCCTAGAAGC
ATGGCAGTCCATTTTTTTTGTCCTGATTCATTCAAAAAAGACAAAAAAAGGCCACAGATTGAAC
AATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039094857 ⟹ XP_038950785

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	82,821,184 - 82,836,959 (-)	NCBI
mRatBN7.2	16	76,122,501 - 76,135,039 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_112358	(Get FASTA)	NCBI Sequence Viewer
	XP_038950785	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB05930	(Get FASTA)	NCBI Sequence Viewer
	EDM08897	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000024999
	ENSRNOP00000024999.2
GenBank Protein	Q63651	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_112358 ⟸ NM_031096

- UniProtKB:

Q63651 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MDFGSLETVVANSAFIAARGSFDGSSTPSSRDKKYLAKLRLPPLSKCEGLRDSISLEFDNLCSE
QPIGKRLFQQFLKTDERHVPALELWKDIEDYDTADDDLRPQKAQAILAEYLDPQGTLFCNFLDQ
GMVARVKEGPTGSQDGLFQPLLQATLEHLSQGPFQEYLGSLYFLRFLQWKWLEAQPIGEDWFLD
FRVLGKGGFGEVSACQMKATGKMYACKKLNKKRLKKRKGYQGAIVEKRILAKVHSRFIVSLAYA
FETKTDLCLVMTIMNGGDVRYHIYNVDEENPGFPEPRAIYYTAQIISGLEHLHQRRIVYRDLKP
ENVLLDNDGNIRISDLGLAVELKEGQNKTKGYAGTPGFMAPELLRGEEYDFSVDYFALGVTLYE
MIAARGPFRARGEKVENKELKQRIISEPVKYPEKFSQASKDFCEQLLEKDPEKRLGFRDGTCDA
LRANVLFKDISWRQLEAGMLIPPFIPDSRTVYAKNIQDVGAFSTVKGVVFDKADTEFFQEFASG
NCSIPWQEEMIETGFFGDLNVWRPDGQMPDDMKGITVEEAAPTAKSGMCLIS

hide sequence

RefSeq Acc Id:

ENSRNOP00000024999 ⟸ ENSRNOT00000024999

RefSeq Acc Id:	XP_038950785 ⟸ XM_039094857
- Peptide Label:	isoform X1

Protein Domains

AGC-kinase C-terminal Protein kinase RGS

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q63651-F1-model_v2	AlphaFold	Q63651	1-564	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:619712	AgrOrtholog
BioCyc Gene	G2FUF-10722	BioCyc
Ensembl Genes	ENSRNOG00000018430	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000024999	ENTREZGENE
	ENSRNOT00000024999.5	UniProtKB/TrEMBL
Gene3D-CATH	1.10.167.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Transferase(Phosphotransferase) domain 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	AGC-kinase_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_kinase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GRK1_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Kinase-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Prot_kinase_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Protein_kinase_ATP_BS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RGS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RGS_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RGS_subdomain_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ser/Thr_kinase_AS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:81760	UniProtKB/Swiss-Prot
NCBI Gene	81760	ENTREZGENE
PANTHER	G PROTEIN-COUPLED RECEPTOR KINASE/RIBOSOMAL PROTEIN S6 KINASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR24355:SF11	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Pkinase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RGS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Grk1	PhenoGen
PRINTS	GPCRKINASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	AGC_KINASE_CTER	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PROTEIN_KINASE_ATP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PROTEIN_KINASE_DOM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PROTEIN_KINASE_ST	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RGS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000018430	RatGTEx
SMART	RGS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	S_TK_X	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	S_TKc	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF48097	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF56112	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6IWH5_RAT	UniProtKB/TrEMBL
	G3V8E1_RAT	UniProtKB/TrEMBL
	Q63651	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-01-20	Grk1	G protein-coupled receptpr kinase 1	Rhok	rhodopsin kinase	Symbol and Name updated	1299863	APPROVED
2002-08-07	Rhok	rhodopsin kinase			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

endocrine system

hemolymphoid system

nervous system

renal system

reproductive system

respiratory system

Below cutoff