Nr2c2 (nuclear receptor subfamily 2, group C, member 2)

Gene: Nr2c2 (nuclear receptor subfamily 2, group C, member 2) Rattus norvegicus

Analyze

Symbol:

Nr2c2

Name:

nuclear receptor subfamily 2, group C, member 2

RGD ID:

3201

Description:

Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific; RNA polymerase II cis-regulatory region sequence-specific DNA binding activity; and nuclear receptor activity. Predicted to be involved in several processes, including p38MAPK cascade; positive regulation of myoblast differentiation; and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within lipopolysaccharide-mediated signaling pathway; meiotic cell cycle; and spermatogenesis. Predicted to be located in nucleoplasm. Orthologous to human NR2C2 (nuclear receptor subfamily 2 group C member 2); INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

nuclear receptor subfamily 2 group C member 2; orphan nuclear receptor TR4; orphan receptor TR4; testicular receptor 4; TR4; TR4 orphan receptor; TR4-NS orphan receptor

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	126,167,350 - 126,223,942 (+)	NCBI		GRCr8
mRatBN7.2	4	124,610,216 - 124,666,813 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	124,608,960 - 124,661,902 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	130,104,022 - 130,134,622 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	125,878,455 - 125,909,055 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	124,502,988 - 124,533,588 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	124,005,287 - 124,030,349 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	124,005,280 - 124,030,349 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	189,231,452 - 189,256,039 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	126,319,412 - 126,344,808 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	126,564,252 - 126,589,637 (+)	NCBI
Celera	4	113,554,791 - 113,579,853 (+)	NCBI		Celera
Cytogenetic Map	4	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

3p deletion syndrome (ISO)

endometriosis (ISO)

genetic disease (ISO)

Isolated Noncompaction of the Ventricular Myocardium (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dichloroethane (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,4-methylenedioxymethamphetamine (ISO)

4-hydroxyphenyl retinamide (ISO)

acetamide (EXP)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

amphetamine (EXP)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (EXP)

caffeine (ISO)

copper(II) sulfate (ISO)

coumarin (ISO)

cyclophosphamide (EXP)

cyclosporin A (ISO)

dexamethasone (ISO)

diazinon (ISO)

dichlorine (EXP)

dicrotophos (ISO)

dorsomorphin (ISO)

folic acid (ISO)

FR900359 (ISO)

geldanamycin (ISO)

genistein (ISO)

gentamycin (EXP)

hydralazine (ISO)

Methylazoxymethanol acetate (EXP)

methylmercury chloride (ISO)

ozone (EXP)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

progesterone (ISO)

quercetin (ISO)

SB 431542 (ISO)

sodium arsenate (ISO)

succimer (ISO)

sunitinib (ISO)

tetrachloroethene (ISO)

thimerosal (ISO)

trichostatin A (ISO)

triptonide (ISO)

troglitazone (ISO)

urethane (ISO)

valproic acid (EXP,ISO)

vorinostat (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell differentiation (IBA,IEA)

cerebellum development (ISO)

intracellular receptor signaling pathway (IEA)

lipopolysaccharide-mediated signaling pathway (ISO)

meiotic cell cycle (ISO)

negative regulation of transcription by RNA polymerase II (IEA,ISO)

p38MAPK cascade (ISO)

positive regulation of behavior (ISO)

positive regulation of embryonic development (IBA,IEA,ISO)

positive regulation of myoblast differentiation (ISO)

positive regulation of transcription by RNA polymerase II (IBA,IEA,ISO)

regulation of DNA-templated transcription (IEA)

spermatogenesis (ISO)

Cellular Component

nucleoplasm (IEA,ISO)

nucleus (IEA)

Molecular Function

DNA-binding transcription activator activity, RNA polymerase II-specific (IEA,ISO)

DNA-binding transcription factor activity (IEA,ISO)

nuclear receptor activity (IBA,IEA)

protein binding (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IEA,ISO)

RNA polymerase II transcription regulatory region sequence-specific DNA binding (ISO)

sequence-specific DNA binding (IEA,ISO)

sequence-specific double-stranded DNA binding (ISO)

zinc ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Overexpression of Jazf1 induces cardiac malformation through the upregulation of pro-apoptotic genes in mice.	Bae KB, etal., Transgenic Res. 2011 Oct;20(5):1019-31. doi: 10.1007/s11248-010-9476-4. Epub 2011 Jan 9.
2.	Human and rat TR4 orphan receptors specify a subclass of the steroid receptor superfamily.	Chang C, etal., Proc Natl Acad Sci U S A 1994 Jun 21;91(13):6040-4.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Splice variants of rat TR4 orphan receptor: differential expression of novel sequences in the 5'-untranslated region and C-terminal domain.	Yoshikawa T, etal., Endocrinology 1996 May;137(5):1562-71.
10.	New variants of the human and rat nuclear hormone receptor, TR4: expression and chromosomal localization of the human gene.	Yoshikawa T, etal., Genomics 1996 Jul 15;35(2):361-6.

Additional References at PubMed

PMID:9556573	PMID:10644740	PMID:15199144	PMID:15381082	PMID:15670754	PMID:16414012	PMID:17827404	PMID:17974920	PMID:19131575	PMID:20393820	PMID:22337877	PMID:36280014

Genomics

Comparative Map Data

Nr2c2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	126,167,350 - 126,223,942 (+)	NCBI		GRCr8
mRatBN7.2	4	124,610,216 - 124,666,813 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	124,608,960 - 124,661,902 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	130,104,022 - 130,134,622 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	125,878,455 - 125,909,055 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	124,502,988 - 124,533,588 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	124,005,287 - 124,030,349 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	124,005,280 - 124,030,349 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	189,231,452 - 189,256,039 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	126,319,412 - 126,344,808 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	126,564,252 - 126,589,637 (+)	NCBI
Celera	4	113,554,791 - 113,579,853 (+)	NCBI		Celera
Cytogenetic Map	4	q34	NCBI

NR2C2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	14,947,583 - 15,049,273 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	14,947,583 - 15,053,600 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	14,989,090 - 15,090,780 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	14,964,240 - 15,065,784 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	3	14,964,239 - 15,059,854	NCBI
Celera	3	14,927,498 - 15,029,051 (+)	NCBI		Celera
Cytogenetic Map	3	p25.1	NCBI
HuRef	3	14,980,982 - 15,026,388 (+)	NCBI		HuRef
CHM1_1	3	14,940,196 - 15,041,731 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	14,950,033 - 15,051,696 (+)	NCBI		T2T-CHM13v2.0

Nr2c2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	92,068,426 - 92,150,039 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	92,068,371 - 92,151,275 (+)	Ensembl		GRCm39 Ensembl
GRCm38	6	92,091,418 - 92,173,058 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	92,091,390 - 92,174,294 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	92,041,412 - 92,123,052 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	92,104,498 - 92,133,463 (+)	NCBI		MGSCv36	mm8
Celera	6	93,985,636 - 94,068,601 (+)	NCBI		Celera
Cytogenetic Map	6	D1	NCBI
cM Map	6	41.03	NCBI

Nr2c2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955429	17,386,190 - 17,430,820 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955429	17,386,190 - 17,430,820 (+)	NCBI	ChiLan1.0	ChiLan1.0

NR2C2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	14,928,971 - 15,033,524 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	14,933,922 - 15,040,422 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	14,869,292 - 14,973,977 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	15,220,110 - 15,312,507 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	15,220,110 - 15,306,242 (+)	Ensembl	panpan1.1		panPan2

NR2C2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	5,041,656 - 5,139,859 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	5,052,232 - 5,133,721 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	5,078,881 - 5,176,796 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	5,063,028 - 5,160,979 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	5,062,849 - 5,155,998 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	4,781,343 - 4,879,258 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	5,132,066 - 5,229,600 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	5,115,710 - 5,213,646 (+)	NCBI		UU_Cfam_GSD_1.0

Nr2c2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404942	18,355,583 - 18,417,842 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936602	504,652 - 553,936 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936602	491,821 - 557,790 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NR2C2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	69,464,795 - 69,576,946 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	69,464,798 - 69,577,638 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	76,826,751 - 76,919,612 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NR2C2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	50,882,569 - 50,983,851 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	50,894,802 - 50,977,581 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	115,508,016 - 115,610,568 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nr2c2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624872	953,097 - 981,974 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624872	953,428 - 1,028,738 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Nr2c2
155 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	107
Count of miRNA genes:	95
Interacting mature miRNAs:	99
Transcripts:	ENSRNOT00000014353
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	38465774	146803430	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	44463908	148090542	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	44463908	148090542	Rat
2312567	Glom19	Glomerulus QTL 19	1.9	0.006	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	4	45456990	146803430	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	50119848	146803430	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	56647873	149491524	Rat
1641833	Alc21	Alcohol consumption QTL 21	8.6	0.0001	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	56698790	126192555	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	59948935	154902892	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
61418	Pia5	Pristane induced arthritis QTL 5	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	62277855	128289560	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	64528739	157573521	Rat
61330	Eau1	Experimental allergic uveoretinitis QTL 1		0.0003	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	4	70362013	132642728	Rat
631646	Stl4	Serum triglyceride level QTL 4	6.5	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	4	73169846	132642728	Rat
738015	Pia9	Pristane induced arthritis QTL 9	4.5	0.048	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	80694870	125694870	Rat
1641919	Alc22	Alcohol consumption QTL 22		0.0005	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	81192555	126192555	Rat
70177	Xhs1	X-ray hypersensitivity QTL 1	25.1		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	82798864	152731274	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	83428419	177635233	Rat
634334	Xhs3	X-ray hypersensitivity QTL 3	10		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	84728680	129854654	Rat
1582232	Gluco25	Glucose level QTL 25	3.6	0.0023	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	85253748	148090731	Rat
12798523	Anxrr56	Anxiety related response QTL 56	2.83	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	85253748	150276390	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	85379421	167139601	Rat
61476	Aia3	Adjuvant induced arthritis QTL 3	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	86730991	131730991	Rat
1578662	Bss15	Bone structure and strength QTL 15	19.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	4	87327165	132327165	Rat
1578670	Bss14	Bone structure and strength QTL 14	16.4		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	4	87327165	132327165	Rat
1578655	Bmd11	Bone mineral density QTL 11	11		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	4	90850165	135850165	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	93308457	167139447	Rat
631689	Scl4	Serum cholesterol level QTL 4	1.9	0.008	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	4	95174120	140174120	Rat
61434	Cia3	Collagen induced arthritis QTL 3	4.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	103194656	148194656	Rat
2302049	Pia32	Pristane induced arthritis QTL 32	5.1	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112)	4	105789505	150789505	Rat
731165	Uae21	Urinary albumin excretion QTL 21	2.4	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	106649412	151649412	Rat
61406	Scwia1	Streptococcal cell wall induced arthritis QTL 1	2.3		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	4	106805662	151805662	Rat
7207480	Bss105	Bone structure and strength QTL 105	8.1		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	4	109827074	154827074	Rat
1549832	Bss3	Bone structure and strength QTL 3	11		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	4	109827074	154827074	Rat
737821	Hcar9	Hepatocarcinoma resistance QTL 9	3.7		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	109866907	167139601	Rat
1331759	Hrtrt13	Heart rate QTL 13	3.54628		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	110275411	168266883	Rat
6478760	Anxrr45	Anxiety related response QTL 45		0.06717	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
6478763	Anxrr46	Anxiety related response QTL 46		0.07428	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
12798519	Anxrr54	Anxiety related response QTL 54	2.54	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	114627026	159627026	Rat
1300116	Hrtrt5	Heart rate QTL 5	3.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	116179486	151161268	Rat
724535	Cm18	Cardiac mass QTL 18	2.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	4	118856416	163856416	Rat
1331802	Srn5	Serum renin concentration QTL 5	3.045		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	4	119428175	157578333	Rat
12798527	Anxrr58	Anxiety related response QTL 58	4.11	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	119463257	147278687	Rat
70201	Gcr1	Gastric cancer resistance QTL 1	2.7		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	4	120260281	147278687	Rat
2293840	Kiddil9	Kidney dilation QTL 9	2.9		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	4	120926564	148090731	Rat
634347	Hcar8	Hepatocarcinoma resistance QTL 8	5.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	123143783	168143783	Rat
631683	Bp116	Blood pressure QTL 116		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	124303370	169303370	Rat

Markers in Region

Nr2c2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	124,661,479 - 124,661,661 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	124,029,814 - 124,029,995	NCBI	Rnor6.0
Rnor_5.0	4	189,231,806 - 189,231,987	UniSTS	Rnor5.0
RGSC_v3.4	4	126,344,273 - 126,344,454	UniSTS	RGSC3.4
Celera	4	113,579,318 - 113,579,499	UniSTS
Cytogenetic Map	4	q34	UniSTS

RH138078

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	124,651,528 - 124,651,667 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	124,019,864 - 124,020,002	NCBI	Rnor6.0
Rnor_5.0	4	189,241,799 - 189,241,937	UniSTS	Rnor5.0
RGSC_v3.4	4	126,334,444 - 126,334,582	UniSTS	RGSC3.4
Celera	4	113,569,368 - 113,569,506	UniSTS
RH 3.4 Map	4	736.04	UniSTS
Cytogenetic Map	4	q34	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	36	42	26	19	26	8	8	74	35	41	11	8
Low		7	15	15		15		3
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_017323	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039108266	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039108269	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039108273	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039108274	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039108275	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039108276	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC110333	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AH003598	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ515799	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L27513	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U59454	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U59456	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000014353 ⟹ ENSRNOP00000014354

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	124,636,953 - 124,661,902 (+)	Ensembl
Rnor_6.0 Ensembl	4	124,005,280 - 124,030,349 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000106878 ⟹ ENSRNOP00000091661

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	124,608,960 - 124,661,902 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000108722 ⟹ ENSRNOP00000082748

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	124,637,723 - 124,661,902 (+)	Ensembl

RefSeq Acc Id:

NM_017323 ⟹ NP_059019

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	126,194,080 - 126,223,942 (+)	NCBI
mRatBN7.2	4	124,636,950 - 124,666,813 (+)	NCBI
Rnor_6.0	4	124,005,287 - 124,030,349 (+)	NCBI
Rnor_5.0	4	189,231,452 - 189,256,039 (-)	NCBI
RGSC_v3.4	4	126,319,412 - 126,344,808 (+)	RGD
Celera	4	113,554,791 - 113,579,853 (+)	RGD

Sequence:

show sequence

GAATTCGGCACGAGAAAGAAGCCAGATCCAGAGAGATAGCCTGTACTTGGACCAGACTGCAGAG
CTTAAAAACAGCCCAGCTCAGGTTCAGGTACCCAGGTGACCACTCAGCACGTTGATCCTCGCCT
TTGGTACCACGTACACAGACCTCTCGGCCGGAATCTCCAGGGATGACCAGCCCCTCCCCGCGCA
TCCAGATAATTTCCACCGACTCTGCGGTACGCTCACCTCAGCGCATTCAGATTGTAACAGACCA
GCAGACAGGACAAAAGCTCCAGATAGTCACCGCAGTGGACGCCTCTGGATCCTCTAAACAGCAG
TTCATCCTAACCAGCCCAGATGGAGCTGGAACTGGGAAGGTGATCCTGGCTTCTCCAGAGACAT
CCAGTGCCAAGCAGCTCATATTCACCACCTCAGACAACCTTGTCCCTGGCAGGATCCAGATCGT
CACGGATTCTGCTTCTGTGGAGCGATTGCTGGGGAAGGCAGACGTCCAGCGGCCCCAGGTGGTG
GAGTACTGTGTGGTCTGTGGTGACAAAGCCTCTGGCCGACACTATGGGGCTGTCAGTTGTGAAG
GTTGCAAAGGTTTCTTCAAAAGGAGTGTGAGGAAGAATCTGACCTATAGCTGTCGTAGCAGCCA
AGACTGCATCATCAACAAGCACCACCGCAACCGCTGCCAGTTCTGCCGGCTGAAGAAGTGCCTG
GAGATGGGCATGAAGATGGAGTCTGTACAGAGTGAACGGAAGCCCTTTGATGTGCAACGGGAGA
AACCAAGCAATTGTGCTGCTTCCACTGAGAAGATCTATATCCGGAAAGACCTGAGAAGTCCTCT
GATAGCCACTCCCACATTTGTGGCAGACAAAGATGGATCAAGACAGACTGGTCTTCTTGATCCA
GGGATGCTTGTGAACATCCAACAGCCTTTGATACGTGAGGATGGTACAGTTCTTTTGGCCACGG
ATTCCAAGGCTGAAACAAGCCAAGGAGCTCTAGGTACACTGGCAAATGTAGTGACCTCTCTGGC
CAACCTGAGTGAATCTTTGAACAATGGTGATGCTTCAGAAATGCAGCCAGAGGACCAGTCTGCA
AGTGAAATTACACGGGCATTTGACACCCTAGCGAAAGCACTTAATACCACAGATAGTGCTTCAC
CTCCAAGCCTGGCAGATGGGATAGATGCTAGTGGAGGAGGGAGTATCCATGTCATCAGCAGAGA
TCAGTCAACACCCATCATTGAAGTCGAAGGCCCTCTCCTTTCAGACACACATGTCACATTTAAG
CTTACAATGCCTAGTCCTATGCCAGAGTACCTCAATGTACATTACATCTGCGAGTCTGCATCCC
GCCTGCTTTTCCTCTCCATGCACTGGGCAAGGTCAATCCCAGCCTTCCAGGCACTTGGACAGGA
CTGCAATACCAGCCTGGTACGGGCCTGCTGGAATGAGCTCTTCACTCTTGGCCTGGCCCAGTGT
GCCCAGGTCATGAGTCTCTCCACCATCCTGGCAGCCATTGTCAACCACTTACAGAACAGCATCC
AGGAAGATAAGCTTTCTGGTGACCGGATAAAGCAAGTCATGGAGCACATCTGGAAGCTGCAGGA
GTTCTGTAACAGCATGGCAAAACTGGATATAGACGGTCATGAGTACGCATACCTTAAAGCTATA
GTTCTCTTTAGTCCCGATCATCCAGGTTTGACAGGCACAAGCCAGATTGAGAAATTTCAGGAGA
AGGCACAGATGGAATTACAAGACTATGTGCAGAAAACCTACTCAGAAGACACATACAGATTGGC
CAGGATTCTTGTCCGCCTGCCAGCACTCAGGCTTATGAGCTCCAATATAACAGAAGAACTTTTT
TTTACTGGTCTCATTGGCAATGTTTCAATAGACAGCATAATTCCCTACATCCTAAAGATGGAGA
CAGCAGAATATAATGGCCAGATCACCGGAGCCAGTCTATAGTGCACAGCCAACAGCTGCCAACA
GTGGGATGCCTCCTAGGACTGTGCAGGTGCGAGGGAAGGGAGTGTAGCAGTGTCTTGGTGTGCA
CAGGTGTTCAGTGTGTTAGCACTCTCTGTCATCTCAGACAATAGCAACTGAAGATGAGTAGAAC
TCTTTCCTGCCCTAAGAAACGTTTTCACACCTTTTGGTGAAGCAGATTTTGGAACAATCTTTTA
ATTCAATTTGTATTTAGAAATTCTCAAAGGCAAAAAACAATACTGAAGTTTTATAATGTCAGAG
ACTAGTATTAAAAGAACCTAAGAACAGTATGTGTAAATACATTTAAAAAAAAAGTCCTTGGAAT
TAATAGCTACTAATTACCAGGGTAATGTTAGCACTTGCTAAGCACTTATCAAACCTTAACATCT
TACCTGTGGACAGGGCAAATGGAAACTGCGCTCTTTGTCAAATGCTATGATTCTGTGACACAGG
AGACAATCGTCCACTTATAGCGGCCGCTTCTAGCTGTGTGCATGTAGTGCTGCCTAATCTGTGT
GGTCTGCATGTG

hide sequence

RefSeq Acc Id:

XM_039108266 ⟹ XP_038964194

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	126,167,435 - 126,223,941 (+)	NCBI
mRatBN7.2	4	124,610,217 - 124,666,812 (+)	NCBI

RefSeq Acc Id:

XM_039108269 ⟹ XP_038964197

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	126,167,433 - 126,223,941 (+)	NCBI
mRatBN7.2	4	124,610,300 - 124,666,812 (+)	NCBI

RefSeq Acc Id:

XM_039108273 ⟹ XP_038964201

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	126,179,532 - 126,223,941 (+)	NCBI
mRatBN7.2	4	124,622,401 - 124,666,812 (+)	NCBI

RefSeq Acc Id:

XM_039108274 ⟹ XP_038964202

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	126,167,350 - 126,223,941 (+)	NCBI
mRatBN7.2	4	124,610,222 - 124,666,812 (+)	NCBI

RefSeq Acc Id:

XM_039108275 ⟹ XP_038964203

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	126,168,440 - 126,223,941 (+)	NCBI
mRatBN7.2	4	124,611,281 - 124,666,812 (+)	NCBI

RefSeq Acc Id:

XM_039108276 ⟹ XP_038964204

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	126,167,355 - 126,223,941 (+)	NCBI
mRatBN7.2	4	124,610,228 - 124,666,812 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_059019	(Get FASTA)	NCBI Sequence Viewer
	XP_038964194	(Get FASTA)	NCBI Sequence Viewer
	XP_038964197	(Get FASTA)	NCBI Sequence Viewer
	XP_038964201	(Get FASTA)	NCBI Sequence Viewer
	XP_038964202	(Get FASTA)	NCBI Sequence Viewer
	XP_038964203	(Get FASTA)	NCBI Sequence Viewer
	XP_038964204	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA21475	(Get FASTA)	NCBI Sequence Viewer
	AAB02827	(Get FASTA)	NCBI Sequence Viewer
	AAB91433	(Get FASTA)	NCBI Sequence Viewer
	AAC52777	(Get FASTA)	NCBI Sequence Viewer
	ABF70962	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000014354
	ENSRNOP00000014354.3
	ENSRNOP00000082748
	ENSRNOP00000082748.1
	ENSRNOP00000091661
	ENSRNOP00000091661.1
GenBank Protein	P55094	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_059019 ⟸ NM_017323

- UniProtKB:

P55094 (UniProtKB/Swiss-Prot), A6IBC1 (UniProtKB/TrEMBL), G3V7F5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MTSPSPRIQIISTDSAVRSPQRIQIVTDQQTGQKLQIVTAVDASGSSKQQFILTSPDGAGTGKV
ILASPETSSAKQLIFTTSDNLVPGRIQIVTDSASVERLLGKADVQRPQVVEYCVVCGDKASGRH
YGAVSCEGCKGFFKRSVRKNLTYSCRSSQDCIINKHHRNRCQFCRLKKCLEMGMKMESVQSERK
PFDVQREKPSNCAASTEKIYIRKDLRSPLIATPTFVADKDGSRQTGLLDPGMLVNIQQPLIRED
GTVLLATDSKAETSQGALGTLANVVTSLANLSESLNNGDASEMQPEDQSASEITRAFDTLAKAL
NTTDSASPPSLADGIDASGGGSIHVISRDQSTPIIEVEGPLLSDTHVTFKLTMPSPMPEYLNVH
YICESASRLLFLSMHWARSIPAFQALGQDCNTSLVRACWNELFTLGLAQCAQVMSLSTILAAIV
NHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCNSMAKLDIDGHEYAYLKAIVLFSPDHPGLTGTS
QIEKFQEKAQMELQDYVQKTYSEDTYRLARILVRLPALRLMSSNITEELFFTGLIGNVSIDSII
PYILKMETAEYNGQITGASL

hide sequence

RefSeq Acc Id:

ENSRNOP00000014354 ⟸ ENSRNOT00000014353

RefSeq Acc Id:	XP_038964194 ⟸ XM_039108266
- Peptide Label:	isoform X1
- UniProtKB:	P55094 (UniProtKB/Swiss-Prot), A0A8I6AGK0 (UniProtKB/TrEMBL), A6IBB9 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038964202 ⟸ XM_039108274
- Peptide Label:	isoform X2
- UniProtKB:	P55094 (UniProtKB/Swiss-Prot), A6IBC1 (UniProtKB/TrEMBL), G3V7F5 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038964204 ⟸ XM_039108276
- Peptide Label:	isoform X2
- UniProtKB:	P55094 (UniProtKB/Swiss-Prot), A6IBC1 (UniProtKB/TrEMBL), G3V7F5 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038964197 ⟸ XM_039108269
- Peptide Label:	isoform X2
- UniProtKB:	P55094 (UniProtKB/Swiss-Prot), A6IBC1 (UniProtKB/TrEMBL), G3V7F5 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038964203 ⟸ XM_039108275
- Peptide Label:	isoform X2
- UniProtKB:	P55094 (UniProtKB/Swiss-Prot), A6IBC1 (UniProtKB/TrEMBL), G3V7F5 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038964201 ⟸ XM_039108273
- Peptide Label:	isoform X2
- UniProtKB:	P55094 (UniProtKB/Swiss-Prot), A6IBC1 (UniProtKB/TrEMBL), G3V7F5 (UniProtKB/TrEMBL)

RefSeq Acc Id:

ENSRNOP00000082748 ⟸ ENSRNOT00000108722

RefSeq Acc Id:

ENSRNOP00000091661 ⟸ ENSRNOT00000106878

Protein Domains

NR LBD Nuclear receptor

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P55094-F1-model_v2	AlphaFold	P55094	1-596	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3201	AgrOrtholog
BioCyc Gene	G2FUF-43702	BioCyc
Ensembl Genes	ENSRNOG00000010536	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000014353	ENTREZGENE
	ENSRNOT00000014353.6	UniProtKB/TrEMBL
	ENSRNOT00000106878.1	UniProtKB/TrEMBL
	ENSRNOT00000108722.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.565.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	3.30.50.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	NHR-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NR2C1/2-like_DBD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NR2C1/2-like_LBD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Nucl_hrmn_rcpt_lig-bd	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Nuclear_hrmn_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Znf_hrmn_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Znf_NHR/GATA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:50659	UniProtKB/Swiss-Prot
NCBI Gene	Nr2c2	ENTREZGENE
PANTHER	NUCLEAR HORMONE RECEPTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NUCLEAR RECEPTOR SUBFAMILY 2 GROUP C MEMBER 2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Hormone_recep	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	zf-C4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Nr2c2	PhenoGen
PRINTS	STRDHORMONER	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	STROIDFINGER	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	NR_LBD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NUCLEAR_REC_DBD_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NUCLEAR_REC_DBD_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000010536	RatGTEx
SMART	HOLI	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ZnF_C4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	Glucocorticoid receptor-like (DNA-binding domain)	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF48508	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5ZUI4_RAT	UniProtKB/TrEMBL
	A0A8I6AGK0	ENTREZGENE, UniProtKB/TrEMBL
	A6IBB9	ENTREZGENE, UniProtKB/TrEMBL
	A6IBC1	ENTREZGENE, UniProtKB/TrEMBL
	G3V7F5	ENTREZGENE, UniProtKB/TrEMBL
	NR2C2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q62996_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-04-05	Nr2c2	nuclear receptor subfamily 2, group C, member 2	Tr4	TR4 orphan receptor	Data merged from RGD:621082	737654	APPROVED
2002-08-07	Tr4	TR4 orphan receptor			Symbol and Name status set to provisional	70820	PROVISIONAL
2002-06-10	Nr2c2	nuclear receptor subfamily 2, group C, member 2			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	translocates to nucleus where it recognizes hormone response elements	69908
gene_domains	contains two zinc finger domains	69908
gene_drugs	N-Methyl-D-aspartate treatment markedly increases expression in brain	1298994
gene_expression	protein expressed in brain areas known to be involved in stress response	1298994
gene_expression	Protein and mRNA are expressed in cerebellar granule cells, where a rise in expression levels is correlated with the progression of neuronal maturation	1298994
gene_function	growth hormone receptor	69908
gene_function	involved in stress response	1298994
gene_function	may be involved in neuronal differentiation	1298994
gene_homology	highly homologous to human Nr2c2	69908
gene_protein	596 amino acids; 65.4 kDa	634394
gene_transcript	heterogeneity due to multiple splice variants is represented at 5' end (C terminus of encoded protein)	1298994

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD