Mc3r (melanocortin 3 receptor) - Rat Genome Database

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - GAD

Imported Disease Annotations - MGI

RGD Manual Annotations

Imported Disease Annotations - ClinVar

Imported Disease Annotations - GAD

Imported Disease Annotations - MGI

RGD Manual Annotations

Name: Mc3r
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Mc3r (melanocortin 3 receptor) Rattus norvegicus

Analyze

Symbol:

Mc3r

Name:

melanocortin 3 receptor

RGD ID:

3056

Description:

Enables melanocortin receptor activity and peptide hormone binding activity. Involved in several processes, including adenylate cyclase-modulating G protein-coupled receptor signaling pathway; homoiothermy; and sodium ion homeostasis. Predicted to be active in cytoplasm and plasma membrane. Human ortholog(s) of this gene implicated in obesity. Orthologous to human MC3R (melanocortin 3 receptor); PARTICIPATES IN melanocortin system pathway; G protein mediated signaling pathway via Galphas family; INTERACTS WITH ammonium chloride; bisphenol A; C60 fullerene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

MC3-R; melanocortin receptor 3

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MC3R (melanocortin 3 receptor)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Mc3r (melanocortin 3 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Mc3r (melanocortin 3 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MC3R (melanocortin 3 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MC3R (melanocortin 3 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mc3r (melanocortin 3 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MC3R (melanocortin 3 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MC3R (melanocortin 3 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mc3r (melanocortin 3 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Mc3r (melanocortin 3 receptor)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	MC3R (melanocortin 3 receptor)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mc3r (melanocortin 3 receptor)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mc3r	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	181,434,776 - 181,435,873 (+)	NCBI		GRCr8
mRatBN7.2	3	161,016,347 - 161,017,444 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	161,016,347 - 161,017,444 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	164,826,379 - 164,827,476 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	173,325,381 - 173,326,478 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	171,067,209 - 171,068,306 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	170,252,901 - 170,253,998 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	170,252,901 - 170,253,998 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	176,331,172 - 176,332,269 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	163,158,776 - 163,159,873 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	163,064,613 - 163,065,946 (+)	NCBI
Celera	3	160,219,693 - 160,220,790 (+)	NCBI		Celera
Cytogenetic Map	3	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Acute-Phase Reaction (IEP)

genetic disease (ISO)

obesity (ISO,ISS)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

1H-indole (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

6-propyl-2-thiouracil (ISO)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP)

C60 fullerene (EXP)

cyclosporin A (ISO)

diethylstilbestrol (EXP)

diiodine (ISO)

enzyme inhibitor (EXP)

folic acid (ISO)

ketoconazole (EXP)

N-ethyl-N-nitrosourea (ISO)

naphthalene (ISO)

paracetamol (ISO)

phenylpropanolamine (EXP)

propanal (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

trichloroethene (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-activating G protein-coupled receptor signaling pathway (IBA,ISO)

adenylate cyclase-modulating G protein-coupled receptor signaling pathway (IDA)

circadian regulation of gene expression (ISO,ISS)

G protein-coupled receptor signaling pathway (ISO)

homoiothermy (IMP)

locomotor rhythm (ISO,ISS)

regulation of blood pressure (IMP)

regulation of feeding behavior (ISO,ISS)

regulation of heart rate (IMP)

regulation of metabolic process (IBA)

sodium ion homeostasis (IEP)

Cellular Component

cytoplasm (IBA)

plasma membrane (IBA)

Molecular Function

melanocortin receptor activity (IDA,IMP)

melanocyte-stimulating hormone receptor activity (IBA,ISO)

neuropeptide binding (ISO)

peptide hormone binding (IBA,IDA,IMP)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

G protein mediated signaling pathway via Galphas family (ISO)

melanocortin system pathway (IDA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The genetic association database.	Becker KG, etal., Nat Genet. 2004 May;36(5):431-2.
2.	The melanocortin system in control of inflammation.	Catania A, etal., ScientificWorldJournal. 2010 Sep 14;10:1840-53.
3.	Role of gamma melanocyte-stimulating hormone-renal melanocortin 3 receptor system in blood pressure regulation in salt-resistant and salt-sensitive rats.	Chandramohan G, etal., Metabolism. 2009 Oct;58(10):1424-9. Epub 2009 Jul 1.
4.	Rattus norvegicus melanocortin 3 receptor: a corrected sequence.	Daniels D, etal., Peptides. 2005 Oct;26(10):1835-41.
5.	Agouti-related protein has an inhibitory paracrine role in the rat adrenal gland.	Dhillo WS, etal., Biochem Biophys Res Commun 2003 Jan 31;301(1):102-7.
6.	Co-occurrence of two partially inactivating polymorphisms of MC3R is associated with pediatric-onset obesity.	Feng N, etal., Diabetes. 2005 Sep;54(9):2663-7.
7.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
8.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
9.	Altered hypothalamic leptin, insulin, and melanocortin binding associated with moderate-fat diet and predisposition to obesity.	Irani BG, etal., Endocrinology. 2007 Jan;148(1):310-6. Epub 2006 Oct 5.
10.	Identification of domains directing specificity of coupling to G-proteins for the melanocortin MC3 and MC4 receptors.	Kim CS, etal., J Biol Chem. 2002 Aug 30;277(35):31310-7. Epub 2002 Jun 3.
11.	Effects of melanocortin receptor ligands on thyrotropin-releasing hormone release: evidence for the differential roles of melanocortin 3 and 4 receptors.	Kim MS, etal., J Neuroendocrinol 2002 Apr;14(4):276-82.
12.	A novel melanocortin 3 receptor gene (MC3R) mutation associated with severe obesity.	Lee YS, etal., J Clin Endocrinol Metab. 2002 Mar;87(3):1423-6.
13.	Melanocortin receptors in rat liver cells: change of gene expression and intracellular localization during acute-phase response.	Malik IA, etal., Histochem Cell Biol. 2012 Mar;137(3):279-91. Epub 2011 Dec 20.
14.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
15.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
16.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
17.	Antibodies raised against different extracellular loops of the melanocortin-3 receptor affect energy balance and autonomic function in rats.	Peter JC, etal., J Recept Signal Transduct Res. 2010 Dec;30(6):444-53.
18.	GOA pipeline	RGD automated data pipeline
19.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
20.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
21.	Identification of a receptor for gamma melanotropin and other proopiomelanocortin peptides in the hypothalamus and limbic system.	Roselli-Rehfuss L, etal., Proc Natl Acad Sci U S A 1993 Oct 1;90(19):8856-60.

Additional References at PubMed

PMID:9454589	PMID:12906838	PMID:12960080	PMID:14512273	PMID:14660008	PMID:14688446	PMID:15123576	PMID:15666803	PMID:15927146	PMID:16195498	PMID:16380516	PMID:17077300
PMID:17405938	PMID:17531155	PMID:18285617	PMID:19036988	PMID:19329486	PMID:19743876	PMID:19854868	PMID:22643233	PMID:22872662	PMID:23571710	PMID:26547948	PMID:26852738
PMID:27713523	PMID:31260713

Genomics

Comparative Map Data

Mc3r
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	181,434,776 - 181,435,873 (+)	NCBI		GRCr8
mRatBN7.2	3	161,016,347 - 161,017,444 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	161,016,347 - 161,017,444 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	164,826,379 - 164,827,476 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	173,325,381 - 173,326,478 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	171,067,209 - 171,068,306 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	170,252,901 - 170,253,998 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	170,252,901 - 170,253,998 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	176,331,172 - 176,332,269 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	163,158,776 - 163,159,873 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	163,064,613 - 163,065,946 (+)	NCBI
Celera	3	160,219,693 - 160,220,790 (+)	NCBI		Celera
Cytogenetic Map	3	q42	NCBI

MC3R
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	56,248,732 - 56,249,815 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	56,248,732 - 56,249,815 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	54,823,788 - 54,824,871 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	54,257,196 - 54,258,278 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	20	54,257,195 - 54,258,278	NCBI
Celera	20	51,563,099 - 51,564,182 (+)	NCBI		Celera
Cytogenetic Map	20	q13.2	NCBI
HuRef	20	51,605,969 - 51,607,052 (+)	NCBI		HuRef
CHM1_1	20	54,724,847 - 54,725,930 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	20	58,023,746 - 58,024,829 (+)	NCBI		T2T-CHM13v2.0

Mc3r
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	172,090,412 - 172,093,034 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	172,090,412 - 172,093,034 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	172,248,492 - 172,251,114 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	172,248,492 - 172,251,114 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	172,073,992 - 172,076,614 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	171,939,697 - 171,942,319 (+)	NCBI		MGSCv36	mm8
Celera	2	178,203,122 - 178,205,744 (+)	NCBI		Celera
Cytogenetic Map	2	H3	NCBI
cM Map	2	94.8	NCBI

Mc3r
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955445	2,978,320 - 2,979,291 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955445	2,977,026 - 2,979,375 (-)	NCBI	ChiLan1.0	ChiLan1.0

MC3R
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	61,991,634 - 61,994,494 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	61,984,752 - 61,987,612 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	52,582,826 - 52,585,688 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	53,871,510 - 53,872,598 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

MC3R
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	41,492,371 - 41,494,033 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	41,492,371 - 41,494,033 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	40,740,767 - 40,742,429 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	42,204,101 - 42,206,852 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	42,204,169 - 42,205,831 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	41,443,631 - 41,445,290 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	41,583,159 - 41,584,826 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	42,240,608 - 42,242,272 (+)	NCBI		UU_Cfam_GSD_1.0

Mc3r
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	183,910,782 - 183,913,588 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936875	172,862 - 173,830 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936875	172,764 - 174,446 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MC3R
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	56,868,525 - 56,869,605 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	56,868,525 - 56,869,605 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	63,979,619 - 63,982,530 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MC3R
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	7,867,355 - 7,871,292 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	7,869,518 - 7,870,489 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666050	55,943,272 - 55,946,286 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mc3r
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624790	285,965 - 286,936 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624790	284,586 - 287,268 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Mc3r
4 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	94
Count of miRNA genes:	88
Interacting mature miRNAs:	89
Transcripts:	ENSRNOT00000005871
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	118839124	163839124	Rat
1598877	Bp285	Blood pressure QTL 285	1.5	0.03	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	120538241	165538241	Rat
10755461	Coatc16	Coat color QTL 16			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	3	122438700	167438700	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	124122556	169034231	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	127162703	168026850	Rat
631673	Iddm13	Insulin dependent diabetes mellitus QTL 13	1.3	0.663	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	3	130193298	161695983	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	130656562	169034231	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	130656562	169034231	Rat
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	131635904	169034231	Rat
2298477	Eau4	Experimental allergic uveoretinitis QTL 4		0.0011	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	3	137398739	169034231	Rat
8552952	Pigfal13	Plasma insulin-like growth factor 1 level QTL 13			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	138799500	169034231	Rat
1298068	Bp167	Blood pressure QTL 167		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	141074471	169034231	Rat
1331726	Bp208	Blood pressure QTL 208	3.129		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	141339013	162184794	Rat
2317883	Alcrsp26	Alcohol response QTL 26	1.8	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	3	145526770	169034231	Rat
12879871	Am7	Aortic mass QTL 7		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	145925360	166177555	Rat
12879872	Cm97	Cardiac mass QTL 97		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	145925360	166177555	Rat
12879873	Cm96	Cardiac mass QTL 96		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	145925360	166177555	Rat
12879874	Cm98	Cardiac mass QTL 98		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	145925360	166177555	Rat
12879875	Kidm64	Kidney mass QTL 64		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	145925360	166177555	Rat
12879876	Bw182	Body weight QTL 182		0.003	body mass (VT:0001259)	body weight (CMO:0000012)	3	145925360	166177555	Rat
2301411	Bp320	Blood pressure QTL 320		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	145925360	166177555	Rat
1598854	Memor10	Memory QTL 10	2		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	3	145956084	161299569	Rat
8552791	Vie2	Viral induced encephalitis QTL 2	4.1		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	3	145956084	169034231	Rat
1578666	Vnigr1	Vascular neointimal growth QTL 1	4.6		artery morphology trait (VT:0002191)	artery lumen area (CMO:0001409)	3	149040888	168026850	Rat

Markers in Region

UniSTS:484941

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	161,016,109 - 161,017,647 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	170,252,664 - 170,254,201	NCBI	Rnor6.0
Rnor_5.0	3	176,330,935 - 176,332,472	UniSTS	Rnor5.0
RGSC_v3.4	3	163,158,539 - 163,160,076	UniSTS	RGSC3.4
Celera	3	160,219,456 - 160,220,993	UniSTS
Cytogenetic Map	3	q42	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001025270	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC131024	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY671938	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474062	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000005871 ⟹ ENSRNOP00000005871

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	161,016,347 - 161,017,444 (+)	Ensembl
Rnor_6.0 Ensembl	3	170,252,901 - 170,253,998 (+)	Ensembl

RefSeq Acc Id:

NM_001025270 ⟹ NP_001020441

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	181,434,776 - 181,435,873 (+)	NCBI
mRatBN7.2	3	161,016,347 - 161,017,444 (+)	NCBI
Rnor_6.0	3	170,252,901 - 170,253,998 (+)	NCBI
Rnor_5.0	3	176,331,172 - 176,332,269 (+)	NCBI
RGSC_v3.4	3	163,158,776 - 163,159,873 (+)	RGD
Celera	3	160,219,693 - 160,220,790 (+)	RGD

Sequence:

show sequence

ATCCACAAGAGAAGCACCTAGAAGAAGATTTTTTTTTTCCCAGCAGCTTGCTCAGGGACCCTGC
AGGAGCTGCAGCCGGAACTGGTCCCCGCCGATAACCATGAACTCTTCCTGCTGCCCGTCCTCCT
CTTATCCGACGCTGCCTAACCTCTCCCAGCACCCTGCAGCCCCCTCTGCCAGCAACCGGAGTGG
CAGTGGGTTCTGCGAGCAGGTTTTCATCAAGCCAGAGGTCTTCCTGGCACTGGGCATCGTCAGT
CTGATGGAAAACATCCTGGTGATCCTGGCTGTGGTGAGGAACGGCAACCTGCACTCCCCCATGT
ACTTCTTCCTGTGCAGCCTGGCTGCGGCCGACATGCTGGTGAGCCTGTCCAACTCCCTGGAGAC
CATCATGATCGTGGTTATCAACAGCGACTCCCTGACCTTGGAGGACCAATTCATCCAGCACATG
GACAACATCTTCGACTCTATGATCTGCATCTCCCTGGTGGCCTCCATCTGCAACCTCCTGGCCA
TCGCCGTGGACAGGTACGTCACCATCTTCTATGCCCTCCGTTACCACAGCATCATGACGGTTAG
GAAAGCCCTCTCCTTGATCGTGGCCATCTGGGTCTGCTGCGGCATCTGCGGCGTGATGTTCATC
GTCTACTCCGAGAGCAAGATGGTCATCGTGTGCCTCATCACCATGTTCTTCGCCATGGTGCTGC
TCATGGGCACCCTGTACATCCACATGTTCCTCTTCGCCAGGCTGCACGTCCAGCGCATCGCGGC
ACTGCCACCTGCTGATGGGGTAGCCCCGCAGCAGCACTCGTGCATGAAGGGGGCCGTCACCATC
ACCATCCTGCTGGGGGTTTTCATCTTCTGCTGGGCGCCTTTCTTCCTCCACCTGGTCCTCATCA
TCACCTGCCCCACCAACCCCTACTGCATCTGCTACACGGCGCACTTCAACACCTACCTGGTTCT
CATCATGTGCAACTCTGTCATCGACCCCCTTATCTACGCCTTCCGCAGCCTGGAGCTGCGGAAC
ACCTTCAAGGAGATTCTCTGCGGTTGCAATGGCATGAACGTGGGCTAGGACCCCCGAGGAGGTG
TTCCACGGCTA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001020441	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAU87797	(Get FASTA)	NCBI Sequence Viewer
	EDL85154	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000005871
	ENSRNOP00000005871.3
	ENSRNOP00055006026
	ENSRNOP00060001778
	ENSRNOP00065018103
GenBank Protein	P32244	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001020441 ⟸ NM_001025270

- UniProtKB:

Q4KXA4 (UniProtKB/Swiss-Prot), P32244 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MNSSCCPSSSYPTLPNLSQHPAAPSASNRSGSGFCEQVFIKPEVFLALGIVSLMENILVILAVV
RNGNLHSPMYFFLCSLAAADMLVSLSNSLETIMIVVINSDSLTLEDQFIQHMDNIFDSMICISL
VASICNLLAIAVDRYVTIFYALRYHSIMTVRKALSLIVAIWVCCGICGVMFIVYSESKMVIVCL
ITMFFAMVLLMGTLYIHMFLFARLHVQRIAALPPADGVAPQQHSCMKGAVTITILLGVFIFCWA
PFFLHLVLIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYAFRSLELRNTFKEILCGCNGM
NVG

hide sequence

RefSeq Acc Id:

ENSRNOP00000005871 ⟸ ENSRNOT00000005871

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P32244-F1-model_v2	AlphaFold	P32244	1-323	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3056	AgrOrtholog
BioCyc Gene	G2FUF-46548	BioCyc
Ensembl Genes	ENSRNOG00000004451	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOG00055005008	UniProtKB/Swiss-Prot
	ENSRNOG00060001753	UniProtKB/Swiss-Prot
	ENSRNOG00065014091	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000005871	ENTREZGENE
	ENSRNOT00000005871.5	UniProtKB/Swiss-Prot
	ENSRNOT00055007994	UniProtKB/Swiss-Prot
	ENSRNOT00060002685	UniProtKB/Swiss-Prot
	ENSRNOT00065023252	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot
	Mcort_3_rcpt	UniProtKB/Swiss-Prot
	Melancort_rcpt	UniProtKB/Swiss-Prot
	Melcrt_ACTH_rcpt	UniProtKB/Swiss-Prot
KEGG Report	rno:29310	UniProtKB/Swiss-Prot
NCBI Gene	29310	ENTREZGENE
PANTHER	G-PROTEIN COUPLED RECEPTOR	UniProtKB/Swiss-Prot
	PTHR22750:SF4	UniProtKB/Swiss-Prot
Pfam	7tm_1	UniProtKB/Swiss-Prot
PhenoGen	Mc3r	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot
	MCRFAMILY	UniProtKB/Swiss-Prot
	MELNOCORTINR	UniProtKB/Swiss-Prot
	MELNOCORTN3R	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000004451	RatGTEx
	ENSRNOG00055005008	RatGTEx
	ENSRNOG00060001753	RatGTEx
	ENSRNOG00065014091	RatGTEx
SMART	7TM_GPCR_Srsx	UniProtKB/Swiss-Prot
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot
UniProt	MC3R_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q4KXA4	ENTREZGENE
UniProt Secondary	Q4KXA4	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Mc3r	melanocortin 3 receptor			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in the hypothalamus and limbic system	69884
gene_regulation	activated by gamma-MSH peptides	69884

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

circulatory system

endocrine system

exocrine system

hepatobiliary system

nervous system

reproductive system

Below cutoff