Serpina6 (serpin family A member 6)

Gene: Serpina6 (serpin family A member 6) Rattus norvegicus

Analyze

Symbol:

Serpina6

Name:

serpin family A member 6

RGD ID:

1595901

Description:

Predicted to enable serine-type endopeptidase inhibitor activity and steroid binding activity. Predicted to act upstream of or within glucocorticoid metabolic process. Predicted to be active in extracellular space. Human ortholog(s) of this gene implicated in corticosteroid-binding globulin deficiency. Orthologous to human SERPINA6 (serpin family A member 6); INTERACTS WITH (+)-schisandrin B; (S)-colchicine; 1-naphthyl isothiocyanate.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Cbg; Corticosteroid binding globulin; corticosteroid-binding globulin; MGC112780; serine (or cysteine) peptidase inhibitor, clade A, member 6; serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 6; serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 6 (mapped); serpin A6; serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 6; serpin peptidase inhibitor, clade A, member 6; Serpina6_mapped; transcortin

RGD Orthologs

Alliance Genes

More Info

more info ...

Allele / Splice:

Serpina6^em1Glha

Genetic Models:

SD-Serpina6^em1Glha SD-Serpina6^em1Glha/Rrrc

Candidate Gene For:

Srcrt4

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	128,544,828 - 128,555,064 (-)	NCBI		GRCr8
mRatBN7.2	6	122,780,040 - 122,790,274 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	122,780,043 - 122,790,349 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	122,920,505 - 122,930,725 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	123,215,781 - 123,226,001 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	122,552,673 - 122,562,896 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	127,523,948 - 127,534,178 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	127,523,906 - 127,534,247 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	136,742,720 - 136,752,950 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	127,911,618 - 127,921,851 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	6	120,260,306 - 120,270,532 (-)	NCBI		Celera
Cytogenetic Map	6	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

achondrogenesis type IA (ISO)

Chemical and Drug Induced Liver Injury (ISO)

corticosteroid-binding globulin deficiency (ISO,ISS)

DICER1 syndrome (ISO)

Experimental Liver Cirrhosis (ISO)

genetic disease (ISO)

liver cirrhosis (ISO)

pleuropulmonary blastoma (ISO)

steatotic liver disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

(S)-colchicine (EXP)

1,2-dichloroethane (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

2,3-dimethoxynaphthalene-1,4-dione (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-amino-4,6-dinitrotoluene (EXP)

3,3',5-triiodo-L-thyronine (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-diaminodiphenylmethane (EXP)

4-amino-2,6-dinitrotoluene (EXP)

acetamide (EXP)

aconitine (EXP)

aflatoxin B1 (EXP,ISO)

aristolochic acid A (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

buspirone (EXP)

buta-1,3-diene (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

clofibrate (ISO)

cobalt dichloride (EXP)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

cyproconazole (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

drospirenone (ISO)

epoxiconazole (ISO)

ethanol (ISO)

flutamide (EXP)

fumonisin B1 (ISO)

glafenine (EXP)

GW 4064 (ISO)

indometacin (ISO)

lead(0) (ISO)

leflunomide (EXP)

lipopolysaccharide (ISO)

methapyrilene (EXP)

Mitotane (ISO)

N-nitrosodiethylamine (EXP)

N-nitrosodimethylamine (ISO)

nefazodone (EXP)

nickel atom (ISO)

nimesulide (EXP)

nitrofen (EXP)

norgestimate (ISO)

p-toluidine (EXP)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (EXP,ISO)

perfluorooctanoic acid (EXP,ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

potassium dichromate (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

progesterone (ISO)

propiconazole (ISO)

quercetin (ISO)

resveratrol (EXP,ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

streptozocin (EXP)

tetrachloromethane (EXP,ISO)

Theaflavin 3,3'-digallate (ISO)

thioacetamide (EXP,ISO)

Triptolide (ISO)

valproic acid (ISO)

vancomycin (ISO)

withaferin A (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

glucocorticoid metabolic process (ISO)

Cellular Component

extracellular space (IBA,ISO)

Molecular Function

serine-type endopeptidase inhibitor activity (IBA)

steroid binding (ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Serum corticosteroid-binding globulin concentration and insulin resistance syndrome: a population study.	Fernandez-Real JM, etal., J Clin Endocrinol Metab 2002 Oct;87(10):4686-90.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
4.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:2710140	PMID:3347061	PMID:8039711	PMID:12477932	PMID:16502470	PMID:16980625	PMID:17467234	PMID:17644521	PMID:18513745	PMID:19833863	PMID:23141917	PMID:23279724
PMID:23376485	PMID:23533145	PMID:27418032	PMID:29273683	PMID:36112420	PMID:38015819

Genomics

Comparative Map Data

Serpina6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	128,544,828 - 128,555,064 (-)	NCBI		GRCr8
mRatBN7.2	6	122,780,040 - 122,790,274 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	122,780,043 - 122,790,349 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	122,920,505 - 122,930,725 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	123,215,781 - 123,226,001 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	122,552,673 - 122,562,896 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	127,523,948 - 127,534,178 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	127,523,906 - 127,534,247 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	136,742,720 - 136,752,950 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	127,911,618 - 127,921,851 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	6	120,260,306 - 120,270,532 (-)	NCBI		Celera
Cytogenetic Map	6	q32	NCBI

SERPINA6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	94,304,248 - 94,323,336 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	94,304,248 - 94,323,389 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	94,770,585 - 94,789,673 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	93,840,338 - 93,859,441 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	14	93,840,338 - 93,859,426	NCBI
Celera	14	74,824,369 - 74,843,477 (-)	NCBI		Celera
Cytogenetic Map	14	q32.13	NCBI
HuRef	14	74,950,383 - 74,969,481 (-)	NCBI		HuRef
CHM1_1	14	94,708,390 - 94,727,495 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	14	88,531,534 - 88,550,620 (-)	NCBI		T2T-CHM13v2.0

Serpina6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	103,612,889 - 103,623,477 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	103,612,889 - 103,623,471 (-)	Ensembl		GRCm39 Ensembl
GRCm38	12	103,646,630 - 103,657,218 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	103,646,630 - 103,657,212 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	12	104,884,842 - 104,895,281 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	12	104,047,682 - 104,058,121 (-)	NCBI		MGSCv36	mm8
Celera	12	104,862,913 - 104,873,376 (-)	NCBI		Celera
Cytogenetic Map	12	E	NCBI
cM Map	12	52.98	NCBI

Serpina6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955438	16,356,540 - 16,380,872 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955438	16,356,600 - 16,380,861 (-)	NCBI	ChiLan1.0	ChiLan1.0

SERPINA6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	95,461,767 - 95,480,904 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	94,678,417 - 94,688,646 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	74,936,724 - 74,955,799 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	94,269,299 - 94,288,391 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	94,269,299 - 94,288,391 (-)	Ensembl	panpan1.1		panPan2

SERPINA6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	63,323,896 - 63,341,829 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	63,323,933 - 63,453,708 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	62,900,449 - 62,925,083 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	63,589,497 - 63,614,157 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	63,589,530 - 63,614,404 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	63,266,111 - 63,290,719 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	63,318,270 - 63,342,932 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	63,648,530 - 63,673,205 (-)	NCBI		UU_Cfam_GSD_1.0

LOC101973017
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	11,314,687 - 11,325,700 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936733	2,141,392 - 2,148,151 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936733	2,141,484 - 2,148,129 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SERPINA6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	115,535,697 - 115,554,570 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	115,535,552 - 115,554,536 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	122,544,744 - 122,563,955 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SERPINA6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	72,079,084 - 72,098,549 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	72,077,274 - 72,098,154 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666053	59,312,190 - 59,331,143 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Serpina6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624734	10,637,515 - 10,651,033 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624734	10,638,031 - 10,650,297 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Serpina6
31 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	25
Count of miRNA genes:	24
Interacting mature miRNAs:	25
Transcripts:	ENSRNOT00000012500
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
731173	Uae22	Urinary albumin excretion QTL 22	10.1		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
2290393	Uae37	Urinary albumin excretion QTL 37		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
724536	Uae7	Urinary albumin excretion QTL 7	3.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	72202632	130729475	Rat
1331799	Bp211	Blood pressure QTL 211	3.66407		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	72202632	130919985	Rat
1581550	Pur8	Proteinuria QTL 8			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	72227641	130729205	Rat
1581563	Uae33	Urinary albumin excretion QTL 33			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	72227641	130729205	Rat
738034	Anxrr5	Anxiety related response QTL 5	5.9		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	6	84130881	129130881	Rat
10054138	Gmadr3	Adrenal mass QTL 3	3.68	0.00045	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	6	85140138	130140138	Rat
10054123	Srcrt6	Stress Responsive Cort QTL 6	2.5	0.0043	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	85140138	130140138	Rat
724513	Uae14	Urinary albumin excretion QTL 14	6.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	85311061	133478515	Rat
1300076	Glom8	Glomerulus QTL 8	7	0.000000009	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	6	86894788	131894788	Rat
2303624	Vencon5	Ventilatory control QTL 5	4.45		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	6	88047916	133047916	Rat
1331725	Bp212	Blood pressure QTL 212	3.52475		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	93701310	128713626	Rat
61414	Pia3	Pristane induced arthritis QTL 3	4.5		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	6	94968928	137848904	Rat
12801411	Schws8	Schwannoma susceptibility QTL 8			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	94968928	139968928	Rat
8552796	Vie3	Viral induced encephalitis QTL 3	2.6		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	6	96833997	140994061	Rat
1358355	Srcrt4	Stress Responsive Cort QTL 4	6.39		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	100364669	140994061	Rat
2313399	Anxrr28	Anxiety related response QTL 28			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	6	100671796	132340886	Rat
1331797	Bp213	Blood pressure QTL 213	3.291		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	104085867	128713626	Rat
71111	Iddm8	Insulin dependent diabetes mellitus QTL 8	1.9	0.002	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	6	105156861	140994061	Rat
4145118	Mcs26	Mammary carcinoma susceptibility QTL 26		0.0001	mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	6	106752656	132339866	Rat
737976	Pia24	Pristane induced arthritis QTL 24			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	6	112636280	140994061	Rat
1298087	Iddm18	Insulin dependent diabetes mellitus QTL 18		0.0001	urine glucose amount (VT:0001758)	percentage of study population developing diabetes mellitus during a period of time (CMO:0001114)	6	116506292	130245370	Rat
1641917	Colcr5	Colorectal carcinoma resistance QTL 5	3.18	0.0009	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	6	122549046	137801795	Rat
2293085	Iddm29	Insulin dependent diabetes mellitus QTL 29	7.66		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	6	122549046	140286318	Rat
61329	Eae9	Experimental allergic encephalomyelitis QTL 9	3.7		body mass (VT:0001259)	change in body weight (CMO:0002045)	6	122549046	140994061	Rat

Markers in Region

RH127840

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	122,780,198 - 122,780,408 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	127,524,107 - 127,524,316	NCBI	Rnor6.0
Rnor_5.0	6	136,742,879 - 136,743,088	UniSTS	Rnor5.0
RGSC_v3.4	6	127,911,777 - 127,911,986	UniSTS	RGSC3.4
Celera	6	120,260,465 - 120,260,674	UniSTS
RH 3.4 Map	6	832.3	UniSTS
Cytogenetic Map	6	q32	UniSTS

BF388405

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	122,784,960 - 122,785,152 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	127,528,869 - 127,529,060	NCBI	Rnor6.0
Rnor_5.0	6	136,747,641 - 136,747,832	UniSTS	Rnor5.0
RGSC_v3.4	6	127,916,540 - 127,916,731	UniSTS	RGSC3.4
Celera	6	120,265,227 - 120,265,418	UniSTS
RH 3.4 Map	6	816.09	UniSTS
Cytogenetic Map	6	q32	UniSTS

Genetic Models

This gene Serpina6 is modified in the following models/strains:

SD-Serpina6^em1Glha SD-Serpina6^em1Glha/Rrrc

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High			19	19		19
Medium			22	22		22					6	1
Low		6	15		10		3	3	7	18	13	5	3
Below cutoff	1	10	1		8		4	5	36	9	15	2	4

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001009663	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC094636	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088300	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473982	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209415	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209977	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211289	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218294	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218398	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219289	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000012500 ⟹ ENSRNOP00000012500

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	122,780,043 - 122,790,349 (-)	Ensembl
Rnor_6.0 Ensembl	6	127,523,906 - 127,534,247 (-)	Ensembl

RefSeq Acc Id:

NM_001009663 ⟹ NP_001009663

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	128,544,828 - 128,555,064 (-)	NCBI
mRatBN7.2	6	122,780,040 - 122,790,274 (-)	NCBI
Rnor_6.0	6	127,523,948 - 127,534,178 (-)	NCBI
Rnor_5.0	6	136,742,720 - 136,752,950 (-)	NCBI
RGSC_v3.4	6	127,911,618 - 127,921,851 (-)	RGD
Celera	6	120,260,306 - 120,270,532 (-)	RGD

Sequence:

show sequence

CCTGGGCAGCAAAGCACAACCAGAAGGAACAGCCGGAGCCCACAGCAGCAGACGGCCTGGTCAA
CTGAACAATGTCACTCGCCCTGTATACCTGCCTCCTCTGGCTCTGCACCAGTGGCCTCTGGACT
GCCCAAGCCAGCACTAATGAGAGTTCAAATTCTCACCGAGGCCTGGCTCCCACCAATGTTGACT
TTGCCTTCAACTTGTACCAACGCCTAGTGGCCCTAAATCCAGACAAGAACACCTTAATCTCCCC
AGTGAGCATCTCCATGGCTCTGGCCATGGTATCCCTTGGCTCTGCCCAGACTCAGTCTCTCCAG
AGTCTAGGCTTCAACCTCACAGAGACCTCTGAAGCTGAGATCCACCAGAGTTTCCAGTACCTCA
ATTACCTTCTCAAGCAGTCCGATACTGGCTTAGAGATGAACATGGGCAATGCCATGTTCCTCCT
CCAGAAGCTGAAGCTGAAGGACTCGTTCTTAGCAGACGTCAAACAATACTATGAGTCAGAGGCC
TTGGCCATCGATTTCGAGGACTGGACTAAAGCCAGCCAACAGATCAACCAGCATGTCAAGGATA
AGACACAGGGGAAAATTGAGCATGTGTTCTCAGACCTGGATAGTCCAGCCTCCTTCATCCTGGT
CAACTACATCTTCCTCAGAGGCATATGGGAACTTCCCTTCAGCCCAGAAAATACTAGAGAGGAG
GACTTCTATGTGAATGAGACAAGCACCGTGAAGGTGCCCATGATGGTCCAGTCAGGCAGCATTG
GTTACTTTCGTGACTCAGTCTTCCCCTGCCAGCTGATACAGATGGACTATGTGGGAAATGGAAC
TGCCTTCTTCATTCTTCCAGACCAGGGCCAGATGGACACTGTCATCGCTGCACTTAGTCGGGAC
ACAATTGATAGGTGGGGCAAGCTTATGACCCCAAGGCAGGTGAACCTATACATCCCGAAATTCT
CCATATCTGATACCTATGACCTTAAAGACATGCTGGAAGACCTGAACATTAAGGACTTGCTCAC
CAACCAATCAGATTTCTCAGGCAACACCAAAGATGTTCCCTTGACATTAACGATGGTCCACAAG
GCCATGCTACAACTGGATGAAGGGAATGTGTTGCCTAATTCTACCAACGGGGCTCCCCTACACC
TGCGCTCTGAACCACTTGACATCAAGTTCAACAAGCCCTTCATCCTCCTGCTCTTTGACAAGTT
CACATGGAGCAGCCTGATGATGAGCCAAGTGGTCAATCCAGCCTAAGAACGTGTCCTGAGAAGC
CTTGGTGCCATCTGACTTTGAGGGATGGAAGCCTTTCCCCAGTCTTCTCAGGGTCTCCCCAACC
CAATCTACTTTTAGATAACTAGCAATGAGTAGCCCTTGTTGCCACTCTCAAGACAAAGTCACTT
GAGAAGGGAGCACTGAGAAAGAGGTAACAGTTATTAAAGGATGTTTTTGCAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001009663	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88300	(Get FASTA)	NCBI Sequence Viewer
	EDL81783	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000012500
	ENSRNOP00000012500.4
GenBank Protein	P31211	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001009663 ⟸ NM_001009663
- Peptide Label:	precursor
- UniProtKB:	Q5M822 (UniProtKB/Swiss-Prot), P31211 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MSLALYTCLLWLCTSGLWTAQASTNESSNSHRGLAPTNVDFAFNLYQRLVALNPDKNTLISPVS ISMALAMVSLGSAQTQSLQSLGFNLTETSEAEIHQSFQYLNYLLKQSDTGLEMNMGNAMFLLQK LKLKDSFLADVKQYYESEALAIDFEDWTKASQQINQHVKDKTQGKIEHVFSDLDSPASFILVNY IFLRGIWELPFSPENTREEDFYVNETSTVKVPMMVQSGSIGYFRDSVFPCQLIQMDYVGNGTAF FILPDQGQMDTVIAALSRDTIDRWGKLMTPRQVNLYIPKFSISDTYDLKDMLEDLNIKDLLTNQ SDFSGNTKDVPLTLTMVHKAMLQLDEGNVLPNSTNGAPLHLRSEPLDIKFNKPFILLLFDKFTW SSLMMSQVVNPA hide sequence

RefSeq Acc Id:

ENSRNOP00000012500 ⟸ ENSRNOT00000012500

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P31211-F1-model_v2	AlphaFold	P31211	1-396	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694799

Promoter ID:

EPDNEW_R5322

Type:

initiation region

Name:

Serpina6_1

Description:

serpin family A member 6

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	127,534,195 - 127,534,255	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1595901	AgrOrtholog
BioCyc Gene	G2FUF-36406	BioCyc
Ensembl Genes	ENSRNOG00000009438	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000012500	ENTREZGENE
	ENSRNOT00000012500.8	UniProtKB/Swiss-Prot
Gene3D-CATH	2.30.39.10	UniProtKB/Swiss-Prot
	3.30.497.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7323342	IMAGE-MGC_LOAD
InterPro	Serpin_CS	UniProtKB/Swiss-Prot
	Serpin_dom	UniProtKB/Swiss-Prot
	Serpin_fam	UniProtKB/Swiss-Prot
	Serpin_sf	UniProtKB/Swiss-Prot
	Serpin_sf_1	UniProtKB/Swiss-Prot
	Serpin_sf_2	UniProtKB/Swiss-Prot
KEGG Report	rno:299270	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:109504	IMAGE-MGC_LOAD
NCBI Gene	299270	ENTREZGENE
PANTHER	CORTICOSTEROID-BINDING GLOBULIN	UniProtKB/Swiss-Prot
	PTHR11461	UniProtKB/Swiss-Prot
Pfam	Serpin	UniProtKB/Swiss-Prot
PharmGKB	SERPINA6	RGD
PhenoGen	Serpina6	PhenoGen
PRINTS	LEUSERPINII	UniProtKB/Swiss-Prot
PROSITE	SERPIN	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000009438	RatGTEx
SMART	SERPIN	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF56574	UniProtKB/Swiss-Prot
UniProt	CBG_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q5M822	ENTREZGENE
UniProt Secondary	Q5M822	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-04-13	Serpina6	serpin family A member 6	Serpina6	serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-10-16	Serpina6	serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 6	Serpina6	serpin peptidase inhibitor, clade A, member 6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-03-05	Serpina6	serpin peptidase inhibitor, clade A, member 6	Serpina6	serine (or cysteine) peptidase inhibitor, clade A, member 6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-07	Serpina6	serine (or cysteine) peptidase inhibitor, clade A, member 6	Serpina6	serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2007-04-13		serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 6	Serpina6	serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 6 (mapped)	Name updated	737654	APPROVED
2007-04-13	Serpina6	serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 6 (mapped)	Serpina6_mapped	serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 6 (mapped)	Data merged from RGD:619829	737654	APPROVED
2006-11-20	Serpina6	serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 6 (mapped)			Symbol and Name status set to provisional	70820	PROVISIONAL
2005-11-17	Serpina6_mapped	serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 6 (mapped)	Serpina6	serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 6	Symbol and Name updated	1556543	APPROVED
2003-04-09	Serpina6	serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 6			Symbol and Name updated	629477	APPROVED
2003-03-06	Serpina6	serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 6	Cbg	Corticosteroid binding globulin	Data merged from RGD:2284	628472	PROVISIONAL
2002-08-07	Serpina6				Symbol and Name status set to provisional	70820	PROVISIONAL
2002-06-10	Cbg	Corticosteroid binding globulin			Symbol and Name status set to approved	70586	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM