Odam (odontogenic, ameloblast associated)

Gene: Odam (odontogenic, ameloblast associated) Rattus norvegicus

Analyze

Symbol:

Odam

Name:

odontogenic, ameloblast associated

RGD ID:

1561883

Description:

Involved in odontogenesis. Predicted to be located in several cellular components, including extracellular space; mitotic spindle; and nucleoplasm. Predicted to be active in cytoplasm and nucleus. Orthologous to human ODAM (odontogenic, ameloblast associated); INTERACTS WITH bisphenol A; cadmium dichloride; tributylstannane.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Apin; APIN precursor; odontogenic ameloblast-associated protein; odontogenic, ameloblast asssociated

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	20,472,530 - 20,496,752 (-)	NCBI		GRCr8
mRatBN7.2	14	20,193,286 - 20,202,517 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	20,193,302 - 20,202,517 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	20,123,607 - 20,132,626 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	21,442,493 - 21,451,512 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	20,173,243 - 20,182,287 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	21,842,990 - 21,852,216 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	21,842,990 - 21,852,216 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	21,753,075 - 21,767,321 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	21,714,378 - 21,724,054 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	14	19,595,876 - 19,605,037 (-)	NCBI		Celera
Cytogenetic Map	14	p21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

aflatoxin B1 (ISO)

azathioprine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (EXP)

calcitriol (ISO)

CGP 52608 (ISO)

chlordecone (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

cytarabine (ISO)

doxorubicin (ISO)

malathion (ISO)

paracetamol (ISO)

quercetin (ISO)

testosterone (ISO)

tributylstannane (EXP)

trichloroethene (EXP)

tris(2-butoxyethyl) phosphate (ISO)

urethane (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biomineral tissue development (IEA)

inflammatory response (IEA,ISO)

odontogenesis (IEP)

odontogenesis of dentin-containing tooth (IBA,IEA,ISO)

positive regulation of epithelial cell proliferation involved in wound healing (IEA,ISO)

positive regulation of gene expression (IEA,ISO)

positive regulation of protein phosphorylation (IEA,ISO)

regulation of actin cytoskeleton organization (IEA,ISO)

response to wounding (ISO)

Cellular Component

cell periphery (IEA,ISO)

cytoplasm (IBA,IEA,ISO)

cytosol (IEA,ISO)

extracellular region (IEA,ISO)

extracellular space (IEA,ISO)

mitotic spindle (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IBA,IEA,ISO)

supramolecular fiber (IEA,ISO)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Odontogenic Ameloblast-associated Protein (ODAM) Mediates Junctional Epithelium Attachment to Teeth via Integrin-ODAM-Rho Guanine Nucleotide Exchange Factor 5 (ARHGEF5)-RhoA Signaling.	Lee HK, etal., J Biol Chem. 2015 Jun 5;290(23):14740-53. doi: 10.1074/jbc.M115.648022. Epub 2015 Apr 24.
3.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:14647039	PMID:15234340	PMID:16674676	PMID:17647262	PMID:21092812	PMID:21154245	PMID:22387195

Genomics

Comparative Map Data

Odam
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	20,472,530 - 20,496,752 (-)	NCBI		GRCr8
mRatBN7.2	14	20,193,286 - 20,202,517 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	20,193,302 - 20,202,517 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	20,123,607 - 20,132,626 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	21,442,493 - 21,451,512 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	20,173,243 - 20,182,287 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	21,842,990 - 21,852,216 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	21,842,990 - 21,852,216 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	21,753,075 - 21,767,321 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	21,714,378 - 21,724,054 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	14	19,595,876 - 19,605,037 (-)	NCBI		Celera
Cytogenetic Map	14	p21	NCBI

ODAM
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	70,195,725 - 70,204,576 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	70,195,725 - 70,204,576 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	71,061,442 - 71,070,293 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	71,096,833 - 71,104,882 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	4	68,420,214 - 68,428,263 (+)	NCBI		Celera
Cytogenetic Map	4	q13.3	NCBI
HuRef	4	66,864,474 - 66,872,522 (+)	NCBI		HuRef
CHM1_1	4	71,098,652 - 71,106,701 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	4	73,535,038 - 73,543,889 (+)	NCBI		T2T-CHM13v2.0

Odam
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	88,032,869 - 88,042,668 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	88,032,888 - 88,042,033 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	87,885,010 - 87,894,809 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	87,885,029 - 87,894,174 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	88,314,720 - 88,321,770 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	88,962,048 - 88,968,733 (+)	NCBI		MGSCv36	mm8
MGSCv36	5	87,491,886 - 87,498,571 (+)	NCBI		MGSCv36	mm8
Cytogenetic Map	5	E1	NCBI
cM Map	5	43.56	NCBI

Odam
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955447	2,653,815 - 2,661,043 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955447	2,653,815 - 2,661,043 (-)	NCBI	ChiLan1.0	ChiLan1.0

ODAM
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	59,878,118 - 59,887,218 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	60,074,401 - 60,083,715 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	54,019,039 - 54,028,085 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	60,362,655 - 60,370,747 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	60,362,655 - 60,370,747 (-)	Ensembl	panpan1.1		panPan2

ODAM
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	13	59,588,642 - 59,597,873 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	13	59,588,647 - 59,597,873 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	13	59,315,664 - 59,324,921 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	13	60,383,221 - 60,392,488 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	13	60,383,221 - 60,392,488 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	13	59,997,363 - 60,006,605 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	13	59,501,814 - 59,511,051 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	13	60,648,776 - 60,658,033 (+)	NCBI		UU_Cfam_GSD_1.0

Odam
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405285	15,986,195 - 15,993,294 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936598	4,438,258 - 4,445,316 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936598	4,438,258 - 4,445,316 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ODAM
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	67,058,472 - 67,066,564 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	67,059,284 - 67,068,117 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	148,456,188 - 148,465,034 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ODAM
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	18,676,794 - 18,687,325 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	18,678,422 - 18,685,932 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666084	4,236,479 - 4,251,148 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Odam
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624890	1,623,562 - 1,629,960 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624890	1,622,846 - 1,631,114 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Odam
80 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	20
Count of miRNA genes:	20
Interacting mature miRNAs:	20
Transcripts:	ENSRNOT00000037003
Prediction methods:	Miranda
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2300159	Bmd61	Bone mineral density QTL 61	5.3	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	14	1	26541967	Rat
2300183	Bmd60	Bone mineral density QTL 60	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	14	1	26541967	Rat
619619	Rf4	Renal disease susceptibility QTL 4	4.1	0.002	urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	14	1	32754612	Rat
634352	Apr6	Acute phase response QTL 6	3.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	14	1	41131407	Rat
1300114	Srn2	Serum renin concentration QTL 2	3.27		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	14	3813074	21217635	Rat
70195	Mcs8	Mammary carcinoma susceptibility QTL 8	4.28		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	14	3813074	24531477	Rat
1331740	Bw26	Body weight QTL 26	3.028		body mass (VT:0001259)	body weight (CMO:0000012)	14	3813074	30767156	Rat
1581500	Renag1	Renal agenesis QTL 1			kidney development trait (VT:0000527)	percentage of study population developing unilateral renal agenesis during a period of time (CMO:0000940)	14	8170668	68298175	Rat
1358296	Ael3	Aortic elastin QTL 3	3.7	0.00051	aorta elastin amount (VT:0003905)	aortic elastin	14	8267090	53267090	Rat
2302045	Pia39	Pristane induced arthritis QTL 39	4.9	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G2a level (CMO:0002116)	14	8267090	53267090	Rat
731183	Pia20	Pristane induced arthritis QTL 20	3.55		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	14	9088978	39057237	Rat
2302277	Gluco38	Glucose level QTL 38	5.8		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11030622	28035204	Rat
631839	Niddm37	Non-insulin dependent diabetes mellitus QTL 37	3.37		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11030622	95876975	Rat
631212	Bw5	Body weight QTL5	5.43		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	14	11030812	30320092	Rat
1300140	Srn3	Serum renin concentration QTL 3	3.19		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	14	14875168	30883947	Rat
71117	Niddm17	Non-insulin dependent diabetes mellitus QTL 17	2.35		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	14	17593761	42336881	Rat
631262	Tcas4	Tongue tumor susceptibility QTL 4	7.29		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	14	17622561	42337007	Rat
2313397	Coatc1	Coat color QTL1			coat/hair pigmentation trait (VT:0010463)	coat/hair color measurement (CMO:0001808)	14	18541332	63541332	Rat
61420	Pia6	Pristane induced arthritis QTL 6	4.9		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	14	18631345	42337007	Rat
10755459	Coatc15	Coat color QTL 15		0.01681	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	14	19836944	64836944	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium
Low					2						10
Below cutoff	1	8	5	1	12	1	1	1	5	8	16	1	1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001044274	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063273575	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC097835	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ198380	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000037003 ⟹ ENSRNOP00000035991

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	20,193,302 - 20,202,517 (-)	Ensembl
Rnor_6.0 Ensembl	14	21,842,990 - 21,852,216 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000103950 ⟹ ENSRNOP00000097228

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	20,194,697 - 20,202,517 (-)	Ensembl

RefSeq Acc Id:

NM_001044274 ⟹ NP_001037739

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	20,472,530 - 20,481,760 (-)	NCBI
mRatBN7.2	14	20,193,286 - 20,202,517 (-)	NCBI
Rnor_6.0	14	21,842,990 - 21,852,216 (-)	NCBI
Rnor_5.0	14	21,753,075 - 21,767,321 (-)	NCBI
RGSC_v3.4	14	21,714,378 - 21,724,054 (-)	RGD
Celera	14	19,595,876 - 19,605,037 (-)	RGD

Sequence:

show sequence

TGAGAAAGAAAGGGACACAGATCTTACAAAGAAGTAAGGTATATCATCTGAAAATGAAAATTAT
AATTCTTCTTGGACTCATCGGAGCTACATCGTCAGCCCCGCTTATAACACAGCGTCTATTGTCT
GCTAGCAACAGCCATGAGTTACTCCTGAATCTTAATAATGGTCAACTTTTGCCACTGCAATTTC
AGAGCGCCTTCAACTCCTGGATTCCTCCCTTCCCTGGGCTTCTACAGCAGCAACAGCAGCAGGC
TCAGGTCTCAGGACACCCACAGTTTCCTCTCTCAACACTAGAGAGCTTTGCTGGGCTATTCCCA
AATCAGATACCTTTCTCAAGACAGGTTGGGTTTGCCCAAGGAGGTCAGGCTGGCCAGCCAGACT
TCTCACAGCAGCAGACACCATCTCAGACCCAGCAGGCTAGTCCTATGTCCTATGTGGTTCCTGT
AAAAGTGCCTCAAGATCAAACACAGATGTTTCAGTACTACCCAGTTTACATGCTTCTGCCCTGG
GAGCAACCACAGCAGACAGTCACATCCTCTCCCCAGCAGACAGGGCAGCAGCTATACGAGGAAC
AGATACCATTCTATAATCAATTTGGATTTGTACCACAACAAGCAGAACCTGGTGTACCAGGAGG
ACAGCAGCACTTAGTTCTTGACAGCTTTGTAGGCACAGCTCCAGAAACTCCTGGAATGCCAGCA
GTAGAAGGCCCGCTGTATCCACAAAAAGAACCAATCGGCTTTAAGCAAGATAATGTAGGCGTTT
CCACGCCCTCAACTTCACCAAAACCCGACACGGGCAATTTTTTCACTTCTGAAATAAACCCGAC
GATTGCTCCACTGCTTCCAGAACAGAAGGTCAATGCTGATAGCCTAAGAGAACCATAAGACTTT
GTTTACATCACTCAGAAGTTTTGGAAGAAGATGAGATGGTACCTTGGCGTCTTTTAAAGATTAT
TGTCTTCTTATATGCTAATAGAAGTTTGTTTAATGATATAAAGCCTCTTCACTGATCTCATTTT
TCTTTACTTAAAAAAGATATACTATTGATGTCACAAAAAATAATGTATCATGGAAAAATCCTAT
CTTTATAATGTTGTCATTTCCCCAAAGATTATGGGGTTATATAATCTGGAAAATGACAAGCACT
AAAAATAAAGCATATTTAACCAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063273575 ⟹ XP_063129645

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	20,472,530 - 20,496,752 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001037739	(Get FASTA)	NCBI Sequence Viewer
	XP_063129645	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	ABA54404	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000035991
	ENSRNOP00000035991.3
	ENSRNOP00000097228.1
GenBank Protein	Q3HS83	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001037739 ⟸ NM_001044274
- Peptide Label:	precursor
- UniProtKB:	Q3HS83 (UniProtKB/Swiss-Prot), A0A8I6AW47 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKIIILLGLIGATSSAPLITQRLLSASNSHELLLNLNNGQLLPLQFQSAFNSWIPPFPGLLQQQ QQQAQVSGHPQFPLSTLESFAGLFPNQIPFSRQVGFAQGGQAGQPDFSQQQTPSQTQQASPMSY VVPVKVPQDQTQMFQYYPVYMLLPWEQPQQTVTSSPQQTGQQLYEEQIPFYNQFGFVPQQAEPG VPGGQQHLVLDSFVGTAPETPGMPAVEGPLYPQKEPIGFKQDNVGVSTPSTSPKPDTGNFFTSE INPTIAPLLPEQKVNADSLREP hide sequence

RefSeq Acc Id:

ENSRNOP00000035991 ⟸ ENSRNOT00000037003

RefSeq Acc Id:

ENSRNOP00000097228 ⟸ ENSRNOT00000103950

RefSeq Acc Id:	XP_063129645 ⟸ XM_063273575
- Peptide Label:	isoform X1
- UniProtKB:	F1LR01 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q3HS83-F1-model_v2	AlphaFold	Q3HS83	1-278	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1561883	AgrOrtholog
BioCyc Gene	G2FUF-16139	BioCyc
Ensembl Genes	ENSRNOG00000023372	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000037003	ENTREZGENE
	ENSRNOT00000037003.5	UniProtKB/TrEMBL
	ENSRNOT00000103950.1	UniProtKB/TrEMBL
InterPro	Odam	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:641555	UniProtKB/Swiss-Prot
NCBI Gene	641555	ENTREZGENE
PANTHER	ODONTOGENIC AMELOBLAST-ASSOCIATED PROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR16237	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	ODAM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Odam	PhenoGen
RatGTEx	ENSRNOG00000023372	RatGTEx
UniProt	A0A8I6AW47	ENTREZGENE, UniProtKB/TrEMBL
	F1LR01	ENTREZGENE, UniProtKB/TrEMBL
	ODAM_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-08-16	Odam	odontogenic, ameloblast associated	Odam	odontogenic, ameloblast asssociated	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-03	Odam	odontogenic, ameloblast asssociated	Apin	APIN precursor	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-02-09	Apin	APIN precursor			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar