Orai1 (ORAI calcium release-activated calcium modulator 1)

Gene: Orai1 (ORAI calcium release-activated calcium modulator 1) Rattus norvegicus

Analyze

Symbol:

Orai1

Name:

ORAI calcium release-activated calcium modulator 1

RGD ID:

1311873

Description:

Enables store-operated calcium channel activity. Involved in store-operated calcium entry. Located in growth cone. Human ortholog(s) of this gene implicated in immunodeficiency 9 and tubular aggregate myopathy 2. Orthologous to human ORAI1 (ORAI calcium release-activated calcium modulator 1); PARTICIPATES IN calcium transport pathway; calcium/calcium-mediated signaling pathway; INTERACTS WITH 2,3',4,4',5-Pentachlorobiphenyl; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

calcium release-activated calcium channel protein 1; calcium release-activated calcium modulator 1; LOC304496; protein orai-1; RGD1311873; similar to hypothetical protein FLJ14466; transmembrane protein 142A

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	39,195,139 - 39,209,030 (-)	NCBI		GRCr8
mRatBN7.2	12	33,533,151 - 33,548,361 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	33,534,344 - 33,548,405 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	34,713,038 - 34,727,066 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	35,324,404 - 35,338,430 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	34,376,303 - 34,390,334 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	38,981,903 - 38,995,570 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	38,981,927 - 38,995,570 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	40,878,296 - 40,879,065 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	34,631,248 - 34,646,316 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	34,494,636 - 34,509,704 (-)	NCBI
Celera	12	35,214,491 - 35,228,150 (-)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

congenital structural myopathy (ISO)

genetic disease (ISO)

hypertension (ISO)

immunodeficiency 9 (ISO)

Neoplasm Metastasis (ISO)

tubular aggregate myopathy 1 (ISO)

tubular aggregate myopathy 2 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3',4,4',5-Pentachlorobiphenyl (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

6-propyl-2-thiouracil (EXP)

all-trans-retinoic acid (ISO)

amphetamine (EXP)

benzo[a]pyrene (EXP,ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

C60 fullerene (EXP)

cadmium dichloride (ISO)

calcium atom (EXP,ISO)

calcium(0) (EXP,ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

chlormequat chloride (EXP)

choline (ISO)

copper(II) sulfate (ISO)

corosolic acid (EXP)

Cuprizon (EXP)

dexamethasone (ISO)

dibutyl phthalate (EXP)

epoxiconazole (ISO)

ethanol (EXP,ISO)

fenthion (ISO)

folic acid (ISO)

FR900359 (ISO)

fulvestrant (ISO)

heptachlor (EXP)

indometacin (ISO)

L-methionine (ISO)

lead(0) (ISO)

methylmercury chloride (ISO)

paracetamol (EXP,ISO)

pentachlorophenol (ISO)

pirinixic acid (ISO)

resveratrol (ISO)

rotenone (EXP)

SKF-96365 hydrochloride (EXP)

testosterone (ISO)

thapsigargin (ISO)

titanium dioxide (ISO)

trans-piceid (ISO)

usnic acid (EXP,ISO)

valproic acid (ISO)

vincristine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adaptive immune response (IEA)

calcineurin-NFAT signaling cascade (ISO)

calcium ion import (ISO)

calcium ion transmembrane transport (IEA,ISO)

ion channel modulating, G protein-coupled receptor signaling pathway (ISO)

ligand-gated ion channel signaling pathway (ISO)

mammary gland epithelium development (ISO)

phospholipase C-activating G protein-coupled receptor signaling pathway (ISO)

positive regulation of calcium ion transport (IEA,ISO,ISS)

positive regulation of insulin secretion (ISO)

regulation of calcium ion transport (ISO)

store-operated calcium entry (IBA,IEA,IMP,ISO,ISS)

Cellular Component

basolateral plasma membrane (ISO)

growth cone (IDA)

membrane (IBA,ISO)

membrane raft (ISO,ISS)

plasma membrane (ISO,ISS)

plasma membrane raft (IEA,ISO,ISS)

protein-containing complex (ISO)

Molecular Function

calcium channel activity (ISO)

calmodulin binding (IEA)

identical protein binding (IEA,ISO)

protein binding (IPI,ISO)

store-operated calcium channel activity (IBA,IEA,IMP,ISO,ISS)

Molecular Pathway Annotations Click to see Annotation Detail View

calcium transport pathway (ISO)

calcium/calcium-mediated signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Store-operated Ca2+ entry in sensory neurons: functional role and the effect of painful nerve injury.	Gemes G, etal., J Neurosci. 2011 Mar 9;31(10):3536-49.
3.	Native STIM2 and ORAI1 proteins form a calcium-sensitive and thapsigargin-insensitive complex in cortical neurons.	Gruszczynska-Biegala J and Kuznicki J, J Neurochem. 2013 Sep;126(6):727-38. doi: 10.1111/jnc.12320. Epub 2013 Jun 12.
4.	Differential roles for STIM1 and STIM2 in store-operated calcium entry in rat neurons.	Gruszczynska-Biegala J, etal., PLoS One. 2011 Apr 26;6(4):e19285.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	STIM1 is necessary for store-operated calcium entry in turning growth cones.	Mitchell CB, etal., J Neurochem. 2012 Sep;122(6):1155-66. doi: 10.1111/j.1471-4159.2012.07840.x. Epub 2012 Jul 11.
7.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	STIM proteins: dynamic calcium signal transducers.	Soboloff J, etal., Nat Rev Mol Cell Biol. 2012 Sep;13(9):549-65. doi: 10.1038/nrm3414.
12.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
13.	Elevated Orai1 and STIM1 expressions upregulate MACC1 expression to promote tumor cell proliferation, metabolism, migration, and invasion in human gastric cancer.	Xia J, etal., Cancer Lett. 2016 Oct 10;381(1):31-40. doi: 10.1016/j.canlet.2016.07.014. Epub 2016 Jul 16.

Additional References at PubMed

PMID:15489334	PMID:16645049	PMID:16733527	PMID:16766533	PMID:16807233	PMID:16921383	PMID:17224452	PMID:17343823	PMID:18711860	PMID:18757751	PMID:18768920	PMID:18845811
PMID:18987344	PMID:19075091	PMID:19171672	PMID:19189966	PMID:19249086	PMID:19364762	PMID:19946888	PMID:20018736	PMID:20107038	PMID:20138887	PMID:20194792	PMID:20418871
PMID:20929813	PMID:21330611	PMID:21730292	PMID:21737791	PMID:21750194	PMID:21945734	PMID:21966957	PMID:22050845	PMID:22108917	PMID:22494970	PMID:22534489	PMID:22684549
PMID:22859829	PMID:22944608	PMID:23169006	PMID:23307288	PMID:23334602	PMID:23349245	PMID:23620825	PMID:23840669	PMID:23878392	PMID:24509424	PMID:24996186	PMID:25428882
PMID:25540197	PMID:25636074	PMID:25873305	PMID:26033013	PMID:26494622	PMID:26755740	PMID:27025854	PMID:27099074	PMID:27129253	PMID:27185316	PMID:27393042	PMID:27503411
PMID:28105751	PMID:28155613	PMID:28189550	PMID:28219928	PMID:28698564	PMID:29101179	PMID:29532875	PMID:29634917	PMID:29654766	PMID:29913436	PMID:30589833	PMID:31009360
PMID:31009446	PMID:31415242	PMID:31926404	PMID:32075490	PMID:32146159	PMID:33269647	PMID:37533369	PMID:37686206	PMID:38291755	PMID:38514055

Genomics

Comparative Map Data

Orai1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	39,195,139 - 39,209,030 (-)	NCBI		GRCr8
mRatBN7.2	12	33,533,151 - 33,548,361 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	33,534,344 - 33,548,405 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	34,713,038 - 34,727,066 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	35,324,404 - 35,338,430 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	34,376,303 - 34,390,334 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	38,981,903 - 38,995,570 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	38,981,927 - 38,995,570 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	40,878,296 - 40,879,065 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	34,631,248 - 34,646,316 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	34,494,636 - 34,509,704 (-)	NCBI
Celera	12	35,214,491 - 35,228,150 (-)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

ORAI1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	121,626,530 - 121,643,109 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	121,626,509 - 121,643,218 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	122,064,455 - 122,079,946 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	120,548,858 - 120,564,322 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	12	121,703,577 - 121,719,069 (+)	NCBI		Celera
Cytogenetic Map	12	q24.31	NCBI
HuRef	12	119,077,074 - 119,092,406 (+)	NCBI		HuRef
CHM1_1	12	122,032,834 - 122,048,313 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	121,619,725 - 121,636,322 (+)	NCBI		T2T-CHM13v2.0

Orai1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	123,153,078 - 123,168,515 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	123,153,137 - 123,168,519 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	123,015,074 - 123,030,452 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	123,015,074 - 123,030,456 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	123,465,083 - 123,480,461 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	123,275,691 - 123,290,773 (+)	NCBI		MGSCv36	mm8
Celera	5	120,110,246 - 120,125,811 (+)	NCBI		Celera
Cytogenetic Map	5	F	NCBI
cM Map	5	62.72	NCBI

Orai1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955482	6,731,949 - 6,775,545 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955482	6,731,949 - 6,746,095 (-)	NCBI	ChiLan1.0	ChiLan1.0

LOC100987781
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	129,715,796 - 129,730,170 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	129,712,187 - 129,726,546 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	119,229,069 - 119,243,435 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	122,601,227 - 122,614,990 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

ORAI1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	7,584,276 - 7,599,667 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	7,584,880 - 7,599,401 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	7,743,828 - 7,758,883 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	7,836,101 - 7,851,163 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	7,836,598 - 7,881,528 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	7,767,621 - 7,782,778 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	7,857,940 - 7,873,138 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	7,813,894 - 7,829,022 (-)	NCBI		UU_Cfam_GSD_1.0

Orai1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	156,736,358 - 156,749,328 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936558	2,730,098 - 2,743,062 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ORAI1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	31,011,644 - 31,027,993 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	31,012,212 - 31,028,008 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	32,817,278 - 32,818,011 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3
Sscrofa10.2	14	32,882,749 - 32,883,075 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ORAI1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	116,997,375 - 117,012,115 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	116,997,636 - 117,011,737 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	127,968,411 - 127,985,052 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Orai1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624747	22,071,404 - 22,085,976 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624747	22,071,373 - 22,085,180 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Orai1
103 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	52
Count of miRNA genes:	50
Interacting mature miRNAs:	52
Transcripts:	ENSRNOT00000001806
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1598855	Bp294	Blood pressure QTL 294	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	1	34851688	Rat
7411660	Foco28	Food consumption QTL 28	10.9	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
9590086	Insglur6	Insulin/glucose ratio QTL 6	18.97	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	12	1	42110980	Rat
8694179	Bw150	Body weight QTL 150	2.9	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411586	Foco5	Food consumption QTL 5	5.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411595	Foco9	Food consumption QTL 9	4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411545	Bw128	Body weight QTL 128	5.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
9590147	Scort7	Serum corticosterone level QTL 7	13.61	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	12	1	42110980	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	1	42450532	Rat
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	1	44465750	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	1	44503507	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	1	44503507	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	1172005	46172005	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	7196730	46669029	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	9603277	46669029	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	10474137	46669029	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	10474137	46669029	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	45055165	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	12351619	46669029	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	12812385	46669029	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	12812385	46669029	Rat
1549902	Bp269	Blood pressure QTL 269			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	13182736	46669029	Rat
1549912	Bp268	Blood pressure QTL 268			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	13182736	46669029	Rat
2302060	Pia37	Pristane induced arthritis QTL 37	6.1	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	13198157	46669029	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	13635523	35682913	Rat
631543	Bp83	Blood pressure QTL 83	5.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	15550826	38478808	Rat
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	19144362	46669029	Rat
737822	Alc10	Alcohol consumption QTL 10	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	19610870	40218516	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610870	42828880	Rat
61324	Eae5	Experimental allergic encephalomyelitis QTL 5	14		nervous system integrity trait (VT:0010566)	percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402)	12	19610870	46669029	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610889	35682913	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	19835789	38193007	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	20328819	46669029	Rat
70169	Eae13	Experimental allergic encephalomyelitis QTL 13		0.032	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	12	24139202	36638073	Rat
1556747	Calcic1	Intracellular calcium level QTL 1		3.6	platelet calcium amount (VT:0010500)	platelet intracellular calcium level (CMO:0000922)	12	28064433	40130419	Rat
1300175	Cm5	Cardiac mass QTL 5	3.78		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	28064433	45899022	Rat
1600386	Calcic2	Intracellular calcium level QTL 2		0.001	platelet physiology trait (VT:0005464)	platelet intracellular calcium level (CMO:0000922)	12	28064433	46669029	Rat
1331787	Rf41	Renal function QTL 41	2.998		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	12	28064557	40218380	Rat
631829	Alc6	Alcohol consumption QTL 6	4.7		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	28607526	37691617	Rat
1300162	Bp188	Blood pressure QTL 188	3.19		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	32103174	45899022	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	31	47	37	19	37	8	11	35	35	37	11	8
Low		12	10	4		4			39		4
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001013982	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC088225	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EU644749	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226607	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000001806 ⟹ ENSRNOP00000001806

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	33,534,344 - 33,548,405 (-)	Ensembl
Rnor_6.0 Ensembl	12	38,981,927 - 38,995,570 (-)	Ensembl

RefSeq Acc Id:

NM_001013982 ⟹ NP_001014004

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	39,195,139 - 39,209,030 (-)	NCBI
mRatBN7.2	12	33,534,320 - 33,548,212 (-)	NCBI
Rnor_6.0	12	38,981,903 - 38,995,570 (-)	NCBI
Rnor_5.0	12	40,878,296 - 40,879,065 (-)	NCBI
RGSC_v3.4	12	34,631,248 - 34,646,316 (-)	RGD
Celera	12	35,214,491 - 35,228,150 (-)	RGD

Sequence:

show sequence

GGGAGGCCGGCGGAGGTGCGGCGCGGCCCCGGGGCCGCAGCCTTCGCAGGCGCCCGCCGCCAGC
CGCGCCTTCGCAGCGTACTCCATGCATCCGGAGCCTGCCCCGCCCCCGAACAACAGCAATCCGG
AGCTTCCCTTGAGCGGCGGCAGCAGCACTAGCGGCAGCCGCCGGAGCCGCCGCCGCAGCGGGGA
CGGGGAGCCCACGGGGGCCCCACCGCTGCCGCCGCCGCCCGCCGTCAGCTACCCGGACTGGATC
GGCCAGAGTTACTCCGAGGTGATGAGCCTCAACGAGCACTCGATGCAGGCGCTGTCCTGGCGCA
AGCTCTACTTGAGCCGCGCCAAGCTCAAAGCCTCCAGCCGAACCTCCGCTCTGCTCTCCGGCTT
CGCCATGGTAGCGATGGTGGAAGTCCAGCTGGACACGGATCATGACTACCCGCCAGGGTTACTC
ATCGTCTTCAGCGCCTGCACCACAGTGCTGGTGGCCGTGCACCTGTTCGCCCTCATGATCAGTA
CCTGCATCCTGCCCAACATCGAGGCTGTGAGCAACGTCCACAACCTCAACTCCGTCAAGGAGTC
GCCGCACGAGCGCATGCACCGCCACATCGAGCTGGCTTGGGCCTTCTCCACCGTCATCGGGACG
CTGCTTTTCCTGGCCGAAGTCGTGCTGCTCTGCTGGGTGAAGTTCTTACCGCTCAAGAGGCAGG
CGGGACAGCCAAGCCCCACCAAGCCACCCACCGAACCGGCCGTCGTCGTCGCCAACAGCAGCAA
CAACGGTGGCATCACCCCGGGTGAGGCGGCTGCCATCGCCTCCACTGCCATCATGGTCCCCTGT
GGCCTGGTGTTTATCGTCTTTGCCGTTCACTTCTACCGCTCACTGGTCAGCCATAAGACGGACC
GACAGTTCCAGGAGCTCAACGAGCTGGCCGAGTTTGCCCGCTTGCAGGACCAGCTGGACCACAG
AGGGGACCATTCTCTAACACCGGGCACCCACTATGCCTAAGTCCTCACCTTCCCACTGGCCCTT
TGAGGCCTTGGCCTTATGCCCTTCCCCATGACCTTGTCCTGGCCCACTCTGGAGGACGGGCTCG
TGCGGGCGGCTGGCTTCACCAGGGCAGAGTGTGGAAGGAAGAGGCTTTAAAAAAAAAAAAAAAA
TCGCTGCAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001014004	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88225	(Get FASTA)	NCBI Sequence Viewer
	ACD02426	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000001806.7
GenBank Protein	Q5M848	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001014004 ⟸ NM_001013982

- UniProtKB:

Q5M848 (UniProtKB/Swiss-Prot), B2ZDP8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MHPEPAPPPNNSNPELPLSGGSSTSGSRRSRRRSGDGEPTGAPPLPPPPAVSYPDWIGQSYSEV
MSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDTDHDYPPGLLIVFSACT
TVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFSTVIGTLLFLAEV
VLLCWVKFLPLKRQAGQPSPTKPPTEPAVVVANSSNNGGITPGEAAAIASTAIMVPCGLVFIVF
AVHFYRSLVSHKTDRQFQELNELAEFARLQDQLDHRGDHSLTPGTHYA

hide sequence

RefSeq Acc Id:

ENSRNOP00000001806 ⟸ ENSRNOT00000001806

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5M848-F1-model_v2	AlphaFold	Q5M848	1-304	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698639

Promoter ID:

EPDNEW_R9160

Type:

initiation region

Name:

Orai1_1

Description:

ORAI calcium release-activated calcium modulator 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	38,995,659 - 38,995,719	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311873	AgrOrtholog
BioCyc Gene	G2FUF-19283	BioCyc
Ensembl Genes	ENSRNOG00000001336	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000001806.8	UniProtKB/TrEMBL
Gene3D-CATH	1.20.140.140	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7322176	IMAGE-MGC_LOAD
InterPro	CRAC_channel	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Orai_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:304496	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:108979	IMAGE-MGC_LOAD
NCBI Gene	304496	ENTREZGENE
PANTHER	CALCIUM RELEASE-ACTIVATED CALCIUM CHANNEL PROTEIN 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR31501	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Orai-1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Orai1	PhenoGen
RatGTEx	ENSRNOG00000001336	RatGTEx
UniProt	B2ZDP8	ENTREZGENE, UniProtKB/TrEMBL
	CRCM1_RAT	UniProtKB/Swiss-Prot
	F1LNX2_RAT	UniProtKB/TrEMBL
	Q5M848	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-27	Orai1	ORAI calcium release-activated calcium modulator 1	RGD1311873	similar to hypothetical protein FLJ14466	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1311873	similar to hypothetical protein FLJ14466	RGD1311873_predicted	similar to hypothetical protein FLJ14466 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1311873_predicted	similar to hypothetical protein FLJ14466 (predicted)	LOC304496_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC304496_predicted	similar to hypothetical protein FLJ14466 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations