Actr2 (actin related protein 2) - Rat Genome Database

Name: Actr2
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Actr2 (actin related protein 2) Rattus norvegicus

Analyze

Symbol:

Actr2

Name:

actin related protein 2

RGD ID:

1310826

Description:

Enables cytoskeletal protein binding activity. Involved in several processes, including cellular response to trichostatin A; positive regulation of dendritic spine morphogenesis; and response to ethanol. Located in lamellipodium and podosome core. Is active in postsynapse. Orthologous to human ACTR2 (actin related protein 2); PARTICIPATES IN insulin responsive facilitative sugar transporter mediated glucose transport pathway; Rab family mediated signaling pathway; platelet-derived growth factor signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine; 3,4-methylenedioxymethamphetamine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

actin-like protein 2; actin-related protein 2; ARP2 actin related protein 2 homolog; ARP2 actin-related protein 2 homolog; ARP2 actin-related protein 2 homolog (yeast); LOC289820; MGC95085

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ACTR2 (actin related protein 2)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Actr2 (actin related protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Actr2 (actin related protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ACTR2 (actin related protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ACTR2 (actin related protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Actr2 (actin related protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ACTR2 (actin related protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ACTR2 (actin related protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Actr2 (actin related protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ACTR2 (actin related protein 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Actr2 (actin related protein 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	actr2b (actin related protein 2b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	actr2a (actin related protein 2a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ARP2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Arp2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	arx-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	actr2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	98,500,119 - 98,535,092 (-)	NCBI		GRCr8
mRatBN7.2	14	94,296,443 - 94,333,735 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	94,296,443 - 94,340,524 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	98,639,283 - 98,680,250 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	99,879,572 - 99,920,537 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	96,346,941 - 96,387,904 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	104,338,486 - 104,375,840 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	104,340,434 - 104,375,649 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	104,072,596 - 104,109,950 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	100,848,391 - 100,883,833 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	100,867,618 - 100,903,044 (-)	NCBI
Celera	14	93,318,648 - 93,356,930 (-)	NCBI		Celera
Cytogenetic Map	14	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Brain Injuries (IEP)

colorectal carcinoma (ISO)

genetic disease (ISO)

lung disease (ISO)

Puromycin Aminonucleoside Nephrosis (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

1,8-cineole (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-methylcholine (ISO)

3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (EXP)

3,4-methylenedioxymethamphetamine (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

aluminium oxide (ISO)

amitrole (EXP)

Aroclor 1254 (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

cadmium atom (ISO)

carbon nanotube (ISO)

chloropicrin (ISO)

chlorpyrifos (ISO)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

D-glucose (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

dibutyl phthalate (EXP,ISO)

ethanol (EXP)

folic acid (ISO)

fumonisin B1 (ISO)

geldanamycin (ISO)

gentamycin (EXP)

glucose (ISO)

indometacin (ISO)

ivermectin (ISO)

methimazole (EXP)

methotrexate (ISO)

N,N-diethyl-m-toluamide (EXP)

nickel atom (ISO)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (EXP)

permethrin (EXP)

phenobarbital (EXP)

pirinixic acid (ISO)

potassium dichromate (ISO)

propiconazole (EXP)

resveratrol (ISO)

rimonabant (ISO)

sodium arsenite (EXP)

sulfadimethoxine (EXP)

tamoxifen (ISO)

tetrachloromethane (ISO)

theophylline (ISO)

thimerosal (ISO)

thioacetamide (EXP)

topotecan (EXP)

trichostatin A (EXP,ISO)

uranium atom (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vincristine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

actin cytoskeleton organization (ISO)

Arp2/3 complex-mediated actin nucleation (IBA,IEA,ISO,ISS)

associative learning (IEP)

asymmetric cell division (IEA,ISO)

cellular response to trichostatin A (IEP)

cellular response to type II interferon (IEA,ISO)

cilium assembly (IEA,ISO)

cytosolic transport (IEA,ISO)

establishment or maintenance of cell polarity (IEA,ISO)

meiotic cell cycle (ISO)

meiotic chromosome movement towards spindle pole (IEA,ISO)

meiotic cytokinesis (IEA,ISO)

positive regulation of dendritic spine morphogenesis (IMP)

positive regulation of double-strand break repair via homologous recombination (IEA,ISO,ISS)

positive regulation of lamellipodium assembly (IEA,ISO)

positive regulation of transcription by RNA polymerase II (IEA,ISO,ISS)

regulation of double-strand break repair via nonhomologous end joining (ISO,ISS)

response to ethanol (IEP)

response to immobilization stress (IEP)

spindle localization (IEA,ISO)

Cellular Component

actin cap (IEA,ISO)

Arp2/3 protein complex (IBA,IEA,ISO,ISS)

cell cortex (ISO)

cell projection (IEA)

cytoplasm (ISO,ISS)

cytosol (IEA)

lamellipodium (IDA)

nucleus (IEA,ISO,ISS)

podosome core (IDA)

postsynapse (EXP,IDA)

site of double-strand break (IEA,ISO,ISS)

Molecular Function

actin filament binding (IBA,IEA,ISO)

ATP binding (IEA)

cytoskeletal protein binding (IDA)

protein binding (IPI,ISO)

structural constituent of cytoskeleton (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

insulin responsive facilitative sugar transporter mediated glucose transport pathway (IMP)

platelet-derived growth factor signaling pathway (ISO)

Rab family mediated signaling pathway (IMP)

References

References - curated

#	Reference Title	Reference Citation
1.	Abl silencing inhibits CAS-mediated process and constriction in resistance arteries.	Anfinogenova Y, etal., Circ Res. 2007 Aug 17;101(4):420-8. Epub 2007 Jul 5.
2.	Phosphorylation of coronin 1B by protein kinase C regulates interaction with Arp2/3 and cell motility.	Cai L, etal., J Biol Chem. 2005 Sep 9;280(36):31913-23. Epub 2005 Jul 18.
3.	F-actin binding is essential for coronin 1B function in vivo.	Cai L, etal., J Cell Sci. 2007 May 15;120(Pt 10):1779-90. Epub 2007 Apr 24.
4.	Arp2/3- and cofilin-coordinated actin dynamics is required for insulin-mediated GLUT4 translocation to the surface of muscle cells.	Chiu TT, etal., Mol Biol Cell. 2010 Oct 15;21(20):3529-39. doi: 10.1091/mbc.E10-04-0316. Epub 2010 Aug 25.
5.	Proteomic analysis of alternative protein tyrosine phosphorylation in 1,2-dichlorovinyl-cysteine-induced cytotoxicity in primary cultured rat renal proximal tubular cells.	de Graauw M, etal., J Pharmacol Exp Ther. 2007 Jul;322(1):89-100. Epub 2007 Apr 18.
6.	N-WASP and cortactin are involved in invadopodium-dependent chemotaxis to EGF in breast tumor cells.	Desmarais V, etal., Cell Motil Cytoskeleton. 2009 Jun;66(6):303-16. doi: 10.1002/cm.20361.
7.	Stress-induced sensitization to cocaine: actin cytoskeleton remodeling within mesocorticolimbic nuclei.	Esparza MA, etal., Eur J Neurosci. 2012 Oct;36(8):3103-17. doi: 10.1111/j.1460-9568.2012.08239.x. Epub 2012 Aug 12.
8.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.	Regulation of spine density and morphology by IQGAP1 protein domains.	Jausoro I, etal., PLoS One. 2013;8(2):e56574. doi: 10.1371/journal.pone.0056574. Epub 2013 Feb 18.
10.	Ethanol Attenuates Histiotrophic Nutrition Pathways and Alters the Intracellular Redox Environment and Thiol Proteome during Rat Organogenesis.	Jilek JL, etal., Toxicol Sci. 2015 Oct;147(2):475-89. doi: 10.1093/toxsci/kfv145. Epub 2015 Jul 15.
11.	Phosphorylation of the Arp2/3 complex is necessary to nucleate actin filaments.	LeClaire LL 3rd, etal., J Cell Biol. 2008 Aug 25;182(4):647-54. doi: 10.1083/jcb.200802145.
12.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
13.	Newly identified cytoskeletal components are associated with dynamic changes of podocyte foot processes.	Miao J, etal., Nephrol Dial Transplant. 2009 Nov;24(11):3297-305. doi: 10.1093/ndt/gfp338. Epub 2009 Jul 17.
14.	Involvement of Arp2/3 complex in the process of colorectal carcinogenesis.	Otsubo T, etal., Mod Pathol. 2004 Apr;17(4):461-7.
15.	Semiquantitative proteomic analysis of rat forebrain postsynaptic density fractions by mass spectrometry.	Peng J, etal., J Biol Chem. 2004 May 14;279(20):21003-11. doi: 10.1074/jbc.M400103200. Epub 2004 Mar 12.
16.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
17.	GOA pipeline	RGD automated data pipeline
18.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
19.	Actin filament formation, reorganization and migration are impaired in hepatic stellate cells under influence of trichostatin A, a histone deacetylase inhibitor.	Rombouts K, etal., J Hepatol. 2002 Dec;37(6):788-96.
20.	Regulation of podosome formation, microglial migration and invasion by Ca(2+)-signaling molecules expressed in podosomes.	Siddiqui TA, etal., J Neuroinflammation. 2012 Nov 17;9:250. doi: 10.1186/1742-2094-9-250.
21.	Stimuli associated with the presence or absence of amphetamine regulate cytoskeletal signaling and behavior.	Singer BF, etal., Eur Neuropsychopharmacol. 2016 Oct 6. pii: S0924-977X(16)30835-5. doi: 10.1016/j.euroneuro.2016.09.639.
22.	Relationship between learning and memory deficits and Arp2 expression in the hippocampus in rats with traumatic brain injury.	Xia X, etal., World Neurosurg. 2012 Dec;78(6):689-96. doi: 10.1016/j.wneu.2011.07.042. Epub 2011 Nov 7.
23.	Identification of the shared gene signatures between pulmonary fibrosis and pulmonary hypertension using bioinformatics analysis.	Zhao H, etal., Front Immunol. 2023 Sep 4;14:1197752. doi: 10.3389/fimmu.2023.1197752. eCollection 2023.

Additional References at PubMed

PMID:11741539	PMID:12477932	PMID:15489334	PMID:16854843	PMID:17220302	PMID:17224451	PMID:18297063	PMID:19056867	PMID:19144319	PMID:19199708	PMID:19946888	PMID:20458337
PMID:21423176	PMID:21494665	PMID:21874009	PMID:22684256	PMID:22871113	PMID:23106098	PMID:23376485	PMID:23439682	PMID:23533145	PMID:24625528	PMID:24824085	PMID:29058690
PMID:29925947

Genomics

Comparative Map Data

Actr2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	98,500,119 - 98,535,092 (-)	NCBI		GRCr8
mRatBN7.2	14	94,296,443 - 94,333,735 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	94,296,443 - 94,340,524 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	98,639,283 - 98,680,250 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	99,879,572 - 99,920,537 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	96,346,941 - 96,387,904 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	104,338,486 - 104,375,840 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	104,340,434 - 104,375,649 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	104,072,596 - 104,109,950 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	100,848,391 - 100,883,833 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	100,867,618 - 100,903,044 (-)	NCBI
Celera	14	93,318,648 - 93,356,930 (-)	NCBI		Celera
Cytogenetic Map	14	q22	NCBI

ACTR2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	65,227,831 - 65,271,253 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	65,227,788 - 65,271,253 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	65,454,965 - 65,498,387 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	65,308,406 - 65,351,891 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	65,366,552 - 65,410,036	NCBI
Celera	2	65,301,566 - 65,345,120 (+)	NCBI		Celera
Cytogenetic Map	2	p14	NCBI
HuRef	2	65,189,074 - 65,232,629 (+)	NCBI		HuRef
CHM1_1	2	65,386,192 - 65,429,751 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	65,237,506 - 65,280,921 (+)	NCBI		T2T-CHM13v2.0

Actr2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	20,012,304 - 20,062,951 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	20,012,304 - 20,062,913 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	20,062,304 - 20,112,951 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	20,062,304 - 20,112,913 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	19,962,307 - 20,012,954 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	19,962,307 - 20,012,915 (-)	NCBI		MGSCv36	mm8
Celera	11	22,204,487 - 22,259,500 (-)	NCBI		Celera
Cytogenetic Map	11	A3.1	NCBI
cM Map	11	12.88	NCBI

Actr2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955424	19,293,949 - 19,333,170 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955424	19,293,949 - 19,333,170 (-)	NCBI	ChiLan1.0	ChiLan1.0

ACTR2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	12	61,131,388 - 61,179,542 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2A	61,135,339 - 61,180,922 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	65,289,675 - 65,333,219 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	66,412,786 - 66,456,857 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

ACTR2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	64,696,068 - 64,733,027 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	64,696,111 - 64,730,553 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	64,582,083 - 64,619,025 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	65,705,072 - 65,742,073 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	65,705,085 - 65,742,062 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	65,383,665 - 65,420,656 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	65,691,644 - 65,728,572 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	65,986,809 - 66,023,812 (+)	NCBI		UU_Cfam_GSD_1.0

Actr2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	18,549,870 - 18,591,068 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936491	9,979,427 - 10,022,043 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936491	9,980,228 - 10,021,417 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ACTR2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	76,691,280 - 76,729,252 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	76,691,275 - 76,729,269 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	80,487,347 - 80,525,297 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ACTR2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	41,740,432 - 41,780,045 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	41,739,968 - 41,779,964 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	70,111,314 - 70,152,221 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Actr2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624762	8,281,433 - 8,339,830 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624762	8,282,415 - 8,339,818 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Actr2
208 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	37
Count of miRNA genes:	33
Interacting mature miRNAs:	35
Transcripts:	ENSRNOT00000006607
Prediction methods:	Microtar, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2317879	Alcrsp27	Alcohol response QTL 27	3.3	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	14	56631369	101631369	Rat
4889951	Bss92	Bone structure and strength QTL 92	3.9		tibia area (VT:1000281)	tibia-fibula cortical bone total cross-sectional area (CMO:0001721)	14	82057471	95876975	Rat
9590294	Uminl4	Urine mineral level QTL 4	5.66	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	14	55624247	100624247	Rat
631523	Pia13	Pristane induced arthritis QTL 13	3.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	14	40793460	98037301	Rat
631839	Niddm37	Non-insulin dependent diabetes mellitus QTL 37	3.37		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11030622	95876975	Rat
634328	Hc5	Hypercalciuria QTL 5	2.3		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	14	58184885	103184885	Rat
9589034	Epfw11	Epididymal fat weight QTL 11	6	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	14	55624247	100624247	Rat
1300136	Rf22	Renal function QTL 22	3.9		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	14	42262529	95023211	Rat
1549834	Scl45	Serum cholesterol level QTL 45	5.8		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	14	50023211	95023211	Rat
1582201	Sffal2	Serum free fatty acids level QTL 2	4	0.0002	blood free fatty acid amount (VT:0001553)	serum free fatty acids level (CMO:0000547)	14	92553886	95876975	Rat
1582250	Gluco26	Glucose level QTL 26	3.3	0.0009	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	73415323	95876975	Rat
1582259	Gluco23	Glucose level QTL 23	3.1	0.0008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	70053989	104886043	Rat
1641900	Alcrsp11	Alcohol response QTL 11			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	14	70053989	104886043	Rat
631213	Bw60	Body weight QTL60	4.51		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	14	79950921	95876975	Rat
2300197	Scl59	Serum cholesterol level QTL 59			blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	14	55147478	100147478	Rat

Markers in Region

RH144671

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	94,303,260 - 94,303,437 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	104,345,231 - 104,345,407	NCBI	Rnor6.0
Rnor_5.0	14	104,079,341 - 104,079,517	UniSTS	Rnor5.0
RGSC_v3.4	14	100,853,576 - 100,853,752	UniSTS	RGSC3.4
Celera	14	93,323,148 - 93,323,324	UniSTS
RH 3.4 Map	14	745.89	UniSTS
Cytogenetic Map	14	q22	UniSTS

RH139107

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	94,298,334 - 94,298,495 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	104,340,379 - 104,340,539	NCBI	Rnor6.0
Rnor_5.0	14	104,074,489 - 104,074,649	UniSTS	Rnor5.0
RGSC_v3.4	14	100,847,987 - 100,848,147	UniSTS	RGSC3.4
Celera	14	93,318,244 - 93,318,404	UniSTS
Cytogenetic Map	14	q22	UniSTS

AA818437

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	94,298,988 - 94,299,078 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	104,341,033 - 104,341,122	NCBI	Rnor6.0
Rnor_5.0	14	104,075,143 - 104,075,232	UniSTS	Rnor5.0
RGSC_v3.4	14	100,848,641 - 100,848,730	UniSTS	RGSC3.4
Celera	14	93,318,898 - 93,318,987	UniSTS
RH 3.4 Map	14	746.28	UniSTS
Cytogenetic Map	14	q22	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001009268	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC088442	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473996	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212547	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212814	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219071	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219838	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220376	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225424	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226083	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226422	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227142	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227488	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227830	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227963	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230292	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230874	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231828	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231874	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233785	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234230	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234307	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ235071	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ235201	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000006607 ⟹ ENSRNOP00000006607

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	94,298,758 - 94,333,664 (-)	Ensembl
Rnor_6.0 Ensembl	14	104,340,434 - 104,375,649 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000101111 ⟹ ENSRNOP00000081949

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	94,321,952 - 94,340,524 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000109487 ⟹ ENSRNOP00000083980

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	94,296,443 - 94,333,718 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000111423 ⟹ ENSRNOP00000081915

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	94,296,919 - 94,333,719 (-)	Ensembl

RefSeq Acc Id:

NM_001009268 ⟹ NP_001009268

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	98,500,119 - 98,535,092 (-)	NCBI
mRatBN7.2	14	94,298,739 - 94,333,715 (-)	NCBI
Rnor_6.0	14	104,340,783 - 104,375,648 (-)	NCBI
Rnor_5.0	14	104,072,596 - 104,109,950 (-)	NCBI
RGSC_v3.4	14	100,848,391 - 100,883,833 (-)	RGD
Celera	14	93,318,648 - 93,356,930 (-)	RGD

Sequence:

show sequence

CGAGGGCGGGGCCGTGTGGAGGAGGAAGCGGGCCAGGCCGGGCGGCGGCTCACCAGGGCGAACC
ATGGACAGCCAGGGCAGGAAGGTGGTGGTGTGCGACAACGGCACTGGGTTTGTGAAGTGTGGAT
ATGCAGGCTCTAACTTTCCAGAACACATCTTCCCAGCTTTGGTTGGAAGACCTATTATCAGATC
AACCACCAAAGTGGGAAACATTGAAATCAAGGATCTCATGGTTGGCGATGAGGCAAGTGAGCTG
CGCTCCATGTTGGAGGTGAACTACCCGATGGAGAACGGCATCGTGCGCAACTGGGACGACATGA
AGCACCTGTGGGACTACACATTCGGGCCAGAGAAGCTCAATATAGACACCAGGAGCTGCAAGAT
CTTACTTACAGAACCCCCAATGAATCCAACCAAGAACAGAGAGAAGATTGTCGAGGTAATGTTT
GAAACTTACCAGTTTTCTGGTGTGTATGTAGCCATCCAAGCAGTTCTGACTTTGTATGCTCAAG
GTTTACTGACTGGTGTGGTAGTGGACTCTGGAGATGGTGTCACTCACATTTGCCCAGTATATGA
AGGCTTTTCCCTCCCTCACCTTACAAGGAGGCTGGATATTGCTGGGAGGGATATTACCAGGTAT
CTTATCAAGCTGCTGCTGTTGCGAGGATATGCCTTCAACCATTCTGCTGACTTTGAGACAGTTC
GCATGATTAAAGAAAAACTTTGTTATGTGGGTTACAATATTGAGCAAGAGCAGAAGCTGGCCTT
AGAGACCACAGTGCTAGTTGAGTCATACACTCTTCCAGATGGACGTATTATTAAGGTTGGAGGA
GAAAGATTTGAAGCACCAGAAGCTTTATTTCAGCCTCATTTGATCAATGTTGAGGGGGTTGGTG
TTGCTGAATTGCTTTTTAACACAATCCAGGCAGCCGACATTGATACCAGATCTGAATTTTATAA
GCACATTGTGCTTTCTGGAGGTTCTACCATGTATCCTGGCCTGCCATCGAGGTTGGAACGAGAG
CTTAAACAGCTTTACCTAGAACGAGTTCTGAAAGGAGATGTGGAGAAACTTTCGAAATTTAAGA
TCCGCATTGAAGACCCGCCTCGCAGGAAGCACATGGTGTTCTTGGGTGGCGCAGTCCTAGCAGA
CATCATGAAAGACAAAGACAACTTCTGGATGACCAGACAAGAGTACCAAGAAAAGGGTGTCCGT
GTGCTGGAGAAACTCGGTGTGACTGTTCGATAAAATAGCAGGCTTGTCCCCATCACGCCTCTAA
TGCTTTTTCTTTTTCCCTTTTAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001009268	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88442	(Get FASTA)	NCBI Sequence Viewer
	EDL97930	(Get FASTA)	NCBI Sequence Viewer
	EDL97931	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000006607.5
	ENSRNOP00000081915.1
	ENSRNOP00000081949.1
	ENSRNOP00000083980.1
	ENSRNOP00055010290
	ENSRNOP00060019959
	ENSRNOP00065006594
GenBank Protein	Q5M7U6	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001009268 ⟸ NM_001009268

- UniProtKB:

Q5M7U6 (UniProtKB/Swiss-Prot), A6JQ13 (UniProtKB/TrEMBL), A0A8I6GBC3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDEASEL
RSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRSCKILLTEPPMNPTKNREKIVEVMF
ETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRY
LIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGG
ERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERE
LKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGAVLADIMKDKDNFWMTRQEYQEKGVR
VLEKLGVTVR

hide sequence

RefSeq Acc Id:

ENSRNOP00000006607 ⟸ ENSRNOT00000006607

RefSeq Acc Id:

ENSRNOP00000083980 ⟸ ENSRNOT00000109487

RefSeq Acc Id:

ENSRNOP00000081949 ⟸ ENSRNOT00000101111

RefSeq Acc Id:

ENSRNOP00000081915 ⟸ ENSRNOT00000111423

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5M7U6-F1-model_v2	AlphaFold	Q5M7U6	1-394	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699507

Promoter ID:

EPDNEW_R10031

Type:

initiation region

Name:

Actr2_1

Description:

ARP2 actin related protein 2 homolog

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	14	104,375,614 - 104,375,674	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310826	AgrOrtholog
BioCyc Gene	G2FUF-14894	BioCyc
Ensembl Genes	ENSRNOG00000004959	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
	ENSRNOG00055007683	UniProtKB/Swiss-Prot
	ENSRNOG00060014606	UniProtKB/Swiss-Prot
	ENSRNOG00065006058	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000006607.6	UniProtKB/TrEMBL
	ENSRNOT00000101111.1	UniProtKB/TrEMBL
	ENSRNOT00000109487.1	UniProtKB/TrEMBL
	ENSRNOT00000111423.1	UniProtKB/TrEMBL
	ENSRNOT00055012905	UniProtKB/Swiss-Prot
	ENSRNOT00060025056	UniProtKB/Swiss-Prot
	ENSRNOT00065009205	UniProtKB/Swiss-Prot
Gene3D-CATH	3.30.420.40	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7126325	IMAGE-MGC_LOAD
InterPro	Actin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Actin/actin-like_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ATPase_NBD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:289820	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:95085	IMAGE-MGC_LOAD
NCBI Gene	289820	ENTREZGENE
PANTHER	ACTIN-RELATED PROTEIN 2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11937	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Actin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Actr2	PhenoGen
PRINTS	ACTIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	ACTINS_ACT_LIKE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000004959	RatGTEx
	ENSRNOG00055007683	RatGTEx
	ENSRNOG00060014606	RatGTEx
	ENSRNOG00065006058	RatGTEx
SMART	ACTIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF53067	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5ZU02_RAT	UniProtKB/TrEMBL
	A0A8I5ZW15_RAT	UniProtKB/TrEMBL
	A0A8I6GBC3	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2Q2R8_RAT	UniProtKB/TrEMBL
	A6JQ13	ENTREZGENE, UniProtKB/TrEMBL
	A6JQ14_RAT	UniProtKB/TrEMBL
	ARP2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-03-25	Actr2	actin related protein 2	Actr2	ARP2 actin related protein 2 homolog	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-07-21	Actr2	ARP2 actin related protein 2 homolog	Actr2	ARP2 actin-related protein 2 homolog (yeast)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Actr2	ARP2 actin-related protein 2 homolog (yeast)	Actr2_predicted	ARP2 actin-related protein 2 homolog (yeast) (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Actr2_predicted	ARP2 actin-related protein 2 homolog (yeast) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - PID (archival)